Reactome: A Curated Pathway Database
Found 4299 matches:
as
Deletion of residues 143 to 143
Deletion of residues 19 to 28
Deletion of residues 21 to 1703
Deletion of residues 251 to 262
Deletion of residues 269 to 324
Deletion of residues 294 to 297
Deletion of residues 30 to 296
Deletion of residues 304 to 316
Deletion of residues 351 to 351
Deletion of residues 361 to 391
Deletion of residues 364543 to 402673
Deletion of residues 450 to 451
Deletion of residues 459 to 459
Deletion of residues 463 to 466
Deletion of residues 574 to 576
Deletion of residues 576 to 576
Deletion of residues 63404997 to 63425624
Deletion of residues 666 to 809
glycine 101 replaced with L-arginine
glycine 118 replaced with L-aspartic acid
glycine 125 replaced with L-glutamic acid
glycine 129 replaced with L-arginine
glycine 129 replaced with L-glutamic acid
glycine 129 replaced with L-glutamic acid (in Homo sapiens)
glycine 129 replaced with L-glutamic acid (in Homo sapiens)
glycine 129 replaced with L-glutamic acid (in Homo sapiens)
glycine 129 replaced with L-glutamic acid (in Homo sapiens)
glycine 129 replaced with L-glutamic acid (in Homo sapiens)
glycine 129 replaced with L-glutamic acid (in Homo sapiens)
glycine 129 replaced with L-glutamic acid (in Homo sapiens)
glycine 129 replaced with L-glutamic acid (in Homo sapiens)
glycine 129 replaced with L-glutamic acid (in Homo sapiens)
glycine 129 replaced with L-glutamic acid (in Homo sapiens)
glycine 129 replaced with L-glutamic acid (in Homo sapiens)
glycine 129 replaced with L-glutamic acid (in Homo sapiens)
glycine 129 replaced with L-glutamic acid (in Homo sapiens)
glycine 129 replaced with L-glutamic acid (in Homo sapiens)
glycine 129 replaced with L-glutamic acid (in Homo sapiens)
glycine 129 replaced with L-glutamic acid (in Homo sapiens)
glycine 129 replaced with L-glutamic acid (in Homo sapiens)
glycine 129 replaced with L-glutamic acid (in Homo sapiens)
glycine 129 replaced with L-glutamic acid (in Homo sapiens)
glycine 129 replaced with L-glutamic acid (in Homo sapiens)
glycine 129 replaced with L-glutamic acid (in Homo sapiens)
glycine 129 replaced with L-glutamic acid (in Homo sapiens)
glycine 129 replaced with L-glutamic acid (in Homo sapiens)
glycine 129 replaced with L-glutamic acid (in Homo sapiens)
glycine 129 replaced with L-glutamic acid (in Homo sapiens)
glycine 129 replaced with L-glutamic acid (in Homo sapiens)
glycine 129 replaced with L-glutamic acid (in Homo sapiens)
glycine 129 replaced with L-valine
glycine 130 replaced with L-valine
glycine 130 replaced with L-valine (in Homo sapiens)
glycine 130 replaced with L-valine (in Homo sapiens)
glycine 130 replaced with L-valine (in Homo sapiens)
glycine 130 replaced with L-valine (in Homo sapiens)
glycine 130 replaced with L-valine (in Homo sapiens)
glycine 130 replaced with L-valine (in Homo sapiens)
glycine 130 replaced with L-valine (in Homo sapiens)
glycine 130 replaced with L-valine (in Homo sapiens)
glycine 144 replaced with L-arginine
glycine 145 replaced with L-aspartic acid
glycine 172 replaced with unknown
glycine 196 replaced with L-glutamic acid
glycine 196 replaced with L-valine
glycine 1961 replaced with L-glutamic acid
glycine 215 replaced with L-serine
glycine 238 replaced with L-tryptophan
glycine 255 replaced with L-glutamic acid
glycine 275 replaced with L-aspartic acid
glycine 277 replaced with L-tryptophan
glycine 287 replaced with L-valine
glycine 287 replaced with L-valine (in Homo sapiens)
glycine 287 replaced with L-valine (in Homo sapiens)
glycine 287 replaced with L-valine (in Homo sapiens)
glycine 287 replaced with L-valine (in Homo sapiens)
glycine 287 replaced with L-valine (in Homo sapiens)
glycine 287 replaced with L-valine (in Homo sapiens)
glycine 287 replaced with L-valine (in Homo sapiens)
glycine 287 replaced with L-valine (in Homo sapiens)
glycine 287 replaced with L-valine (in Homo sapiens)
glycine 287 replaced with L-valine (in Homo sapiens)
glycine 287 replaced with L-valine (in Homo sapiens)
glycine 292 replaced with L-serine
glycine 301 replaced with L-cysteine
glycine 309 replaced with L-glutamic acid
glycine 338 replaced with L-glutamic acid
glycine 339 replaced with L-aspartic acid
glycine 34 replaced with L-serine
glycine 370 replaced with L-cysteine
glycine 370 replaced with L-cysteine (in Homo sapiens)
glycine 370 replaced with L-cysteine (in Homo sapiens)
glycine 370 replaced with L-cysteine (in Homo sapiens)
glycine 370 replaced with L-cysteine (in Homo sapiens)
glycine 370 replaced with L-cysteine (in Homo sapiens)
glycine 370 replaced with L-cysteine (in Homo sapiens)
glycine 370 replaced with L-cysteine (in Homo sapiens)
glycine 370 replaced with L-cysteine (in Homo sapiens)
glycine 370 replaced with L-cysteine (in Homo sapiens)
glycine 370 replaced with L-cysteine (in Homo sapiens)
glycine 370 replaced with L-cysteine (in Homo sapiens)
glycine 370 replaced with L-cysteine (in Homo sapiens)
glycine 370 replaced with L-cysteine (in Homo sapiens)
glycine 370 replaced with L-cysteine (in Homo sapiens)
glycine 370 replaced with L-cysteine (in Homo sapiens)
glycine 370 replaced with L-cysteine (in Homo sapiens)
glycine 370 replaced with L-cysteine (in Homo sapiens)
glycine 370 replaced with L-cysteine (in Homo sapiens)
glycine 370 replaced with L-cysteine (in Homo sapiens)
glycine 370 replaced with L-cysteine (in Homo sapiens)
glycine 370 replaced with L-cysteine (in Homo sapiens)
glycine 370 replaced with L-cysteine (in Homo sapiens)
glycine 370 replaced with L-cysteine (in Homo sapiens)
glycine 370 replaced with L-cysteine (in Homo sapiens)
glycine 370 replaced with L-cysteine (in Homo sapiens)
glycine 376 replaced with L-arginine
glycine 376 replaced with L-arginine (in Homo sapiens)
glycine 376 replaced with L-arginine (in Homo sapiens)
glycine 376 replaced with L-arginine (in Homo sapiens)
glycine 376 replaced with L-arginine (in Homo sapiens)
glycine 376 replaced with L-arginine (in Homo sapiens)
glycine 376 replaced with L-arginine (in Homo sapiens)
glycine 376 replaced with L-arginine (in Homo sapiens)
glycine 376 replaced with L-arginine (in Homo sapiens)
glycine 376 replaced with L-arginine (in Homo sapiens)
glycine 376 replaced with L-arginine (in Homo sapiens)
glycine 376 replaced with L-arginine (in Homo sapiens)
glycine 376 replaced with L-arginine (in Homo sapiens)
glycine 376 replaced with L-arginine (in Homo sapiens)
glycine 376 replaced with L-arginine (in Homo sapiens)
glycine 376 replaced with L-arginine (in Homo sapiens)
glycine 376 replaced with L-arginine (in Homo sapiens)
glycine 376 replaced with L-arginine (in Homo sapiens)
glycine 376 replaced with L-arginine (in Homo sapiens)
glycine 376 replaced with L-arginine (in Homo sapiens)
glycine 376 replaced with L-arginine (in Homo sapiens)
glycine 376 replaced with L-arginine (in Homo sapiens)
glycine 376 replaced with L-arginine (in Homo sapiens)
glycine 380 replaced with L-arginine
glycine 380 replaced with L-arginine (in Homo sapiens)
glycine 380 replaced with L-arginine (in Homo sapiens)
glycine 380 replaced with L-arginine (in Homo sapiens)
glycine 380 replaced with L-arginine (in Homo sapiens)
glycine 380 replaced with L-arginine (in Homo sapiens)
glycine 380 replaced with L-arginine (in Homo sapiens)
glycine 380 replaced with L-arginine (in Homo sapiens)
glycine 380 replaced with L-arginine (in Homo sapiens)
glycine 380 replaced with L-arginine (in Homo sapiens)
glycine 380 replaced with L-arginine (in Homo sapiens)
glycine 380 replaced with L-arginine (in Homo sapiens)
glycine 380 replaced with L-arginine (in Homo sapiens)
glycine 380 replaced with L-arginine (in Homo sapiens)
glycine 380 replaced with L-arginine (in Homo sapiens)
glycine 380 replaced with L-arginine (in Homo sapiens)
glycine 380 replaced with L-arginine (in Homo sapiens)
glycine 380 replaced with L-arginine (in Homo sapiens)
glycine 380 replaced with L-arginine (in Homo sapiens)
glycine 380 replaced with L-arginine (in Homo sapiens)
glycine 380 replaced with L-arginine (in Homo sapiens)
glycine 380 replaced with L-arginine (in Homo sapiens)
glycine 380 replaced with L-arginine (in Homo sapiens)
glycine 380 replaced with L-arginine (in Homo sapiens)
glycine 380 replaced with L-arginine (in Homo sapiens)
glycine 380 replaced with L-arginine (in Homo sapiens)
glycine 382 replaced with L-aspartic acid
glycine 382 replaced with L-aspartic acid (in Homo sapiens)
glycine 382 replaced with L-aspartic acid (in Homo sapiens)
glycine 382 replaced with L-aspartic acid (in Homo sapiens)
glycine 382 replaced with L-aspartic acid (in Homo sapiens)
glycine 382 replaced with L-aspartic acid (in Homo sapiens)
glycine 382 replaced with L-aspartic acid (in Homo sapiens)
glycine 382 replaced with L-aspartic acid (in Homo sapiens)
glycine 382 replaced with L-aspartic acid (in Homo sapiens)
glycine 382 replaced with L-aspartic acid (in Homo sapiens)
glycine 382 replaced with L-aspartic acid (in Homo sapiens)
glycine 382 replaced with L-aspartic acid (in Homo sapiens)
glycine 382 replaced with L-aspartic acid (in Homo sapiens)
glycine 382 replaced with L-aspartic acid (in Homo sapiens)
glycine 382 replaced with L-aspartic acid (in Homo sapiens)
glycine 382 replaced with L-aspartic acid (in Homo sapiens)
glycine 382 replaced with L-aspartic acid (in Homo sapiens)
glycine 382 replaced with L-aspartic acid (in Homo sapiens)
glycine 382 replaced with L-aspartic acid (in Homo sapiens)
glycine 382 replaced with L-aspartic acid (in Homo sapiens)
glycine 382 replaced with L-aspartic acid (in Homo sapiens)
glycine 382 replaced with L-aspartic acid (in Homo sapiens)
glycine 382 replaced with L-aspartic acid (in Homo sapiens)
glycine 382 replaced with L-aspartic acid (in Homo sapiens)
glycine 382 replaced with L-aspartic acid (in Homo sapiens)
glycine 382 replaced with L-aspartic acid (in Homo sapiens)
glycine 482 replaced with L-tryptophan
glycine 52 replaced with L-arginine
glycine 52 replaced with L-arginine (in Homo sapiens)
glycine 52 replaced with L-arginine (in Homo sapiens)
glycine 52 replaced with L-arginine (in Homo sapiens)
glycine 52 replaced with L-arginine (in Homo sapiens)
glycine 52 replaced with L-arginine (in Homo sapiens)
glycine 52 replaced with L-arginine (in Homo sapiens)
glycine 52 replaced with L-arginine (in Homo sapiens)
glycine 52 replaced with L-arginine (in Homo sapiens)
glycine 52 replaced with L-arginine (in Homo sapiens)
glycine 52 replaced with L-arginine (in Homo sapiens)
glycine 52 replaced with L-arginine (in Homo sapiens)
glycine 52 replaced with L-arginine (in Homo sapiens)
glycine 52 replaced with L-arginine (in Homo sapiens)
glycine 52 replaced with L-arginine (in Homo sapiens)
glycine 57 replaced with L-arginine
glycine 581 replaced with L-serine
glycine 598 replaced with L-valine
glycine 61 replaced with L-glutamic acid
glycine 623 replaced with L-arginine
glycine 697 replaced with L-cysteine
glycine 697 replaced with L-cysteine (in Homo sapiens)
glycine 697 replaced with L-cysteine (in Homo sapiens)
glycine 697 replaced with L-cysteine (in Homo sapiens)
glycine 697 replaced with L-cysteine (in Homo sapiens)
glycine 697 replaced with L-cysteine (in Homo sapiens)
glycine 697 replaced with L-cysteine (in Homo sapiens)
glycine 697 replaced with L-cysteine (in Homo sapiens)
glycine 697 replaced with L-cysteine (in Homo sapiens)
glycine 697 replaced with L-cysteine (in Homo sapiens)
glycine 697 replaced with L-cysteine (in Homo sapiens)
glycine 697 replaced with L-cysteine (in Homo sapiens)
glycine 697 replaced with L-cysteine (in Homo sapiens)
glycine 697 replaced with L-cysteine (in Homo sapiens)
glycine 697 replaced with L-cysteine (in Homo sapiens)
glycine 697 replaced with L-cysteine (in Homo sapiens)
glycine 697 replaced with L-cysteine (in Homo sapiens)
glycine 697 replaced with L-cysteine (in Homo sapiens)
glycine 697 replaced with L-cysteine (in Homo sapiens)
glycine 697 replaced with L-cysteine (in Homo sapiens)
glycine 697 replaced with L-cysteine (in Homo sapiens)
glycine 697 replaced with L-cysteine (in Homo sapiens)
glycine 697 replaced with L-cysteine (in Homo sapiens)
glycine 697 replaced with L-cysteine (in Homo sapiens)
glycine 697 replaced with L-cysteine (in Homo sapiens)
glycine 697 replaced with L-cysteine (in Homo sapiens)
glycine 703 replaced with L-arginine
glycine 719 replaced with L-alanine
glycine 719 replaced with L-cysteine
glycine 719 replaced with L-serine
glycine 719 replaced with L-serine (in Homo sapiens)
glycine 719 replaced with L-serine (in Homo sapiens)
glycine 719 replaced with L-serine (in Homo sapiens)
glycine 719 replaced with L-serine (in Homo sapiens)
glycine 719 replaced with L-serine (in Homo sapiens)
glycine 719 replaced with L-serine (in Homo sapiens)
glycine 719 replaced with L-serine (in Homo sapiens)
glycine 719 replaced with L-serine (in Homo sapiens)
glycine 719 replaced with L-serine (in Homo sapiens)
glycine 719 replaced with L-serine (in Homo sapiens)
glycine 719 replaced with L-serine (in Homo sapiens)
glycine 719 replaced with L-serine (in Homo sapiens)
glycine 719 replaced with L-serine (in Homo sapiens)
glycine 719 replaced with L-serine (in Homo sapiens)
glycine 719 replaced with L-serine (in Homo sapiens)
glycine 719 replaced with L-serine (in Homo sapiens)
glycine 73 replaced with L-glutamic acid
glycine 75 replaced with L-aspartic acid
glycine 75 replaced with L-aspartic acid (in Homo sapiens)
glycine 75 replaced with L-aspartic acid (in Homo sapiens)
glycine 75 replaced with L-aspartic acid (in Homo sapiens)
glycine 75 replaced with L-aspartic acid (in Homo sapiens)
glycine 75 replaced with L-aspartic acid (in Homo sapiens)
glycine 75 replaced with L-aspartic acid (in Homo sapiens)
glycine 75 replaced with L-aspartic acid (in Homo sapiens)
glycine 75 replaced with L-aspartic acid (in Homo sapiens)
glycine 75 replaced with L-aspartic acid (in Homo sapiens)
glycine 75 replaced with L-aspartic acid (in Homo sapiens)
glycine 75 replaced with L-aspartic acid (in Homo sapiens)
glycine 75 replaced with L-aspartic acid (in Homo sapiens)
glycine 79 replaced with L-arginine
glycine 863 replaced with L-alanine
glycine 87 replaced with L-valine
Insertion of residues 143 to 144 at 143 from UniProt:P19099 CYP11B2
Insertion of residues 20 to 517 at 733 from UniProt:P07333 CSF1R
Insertion of residues 270 to 271 at 272 from UniProt:P05108 CYP11A1
Insertion of residues 270 to 273 at 251 from UniProt:Q12794 HYAL1
Insertion of residues 429 to 822 at 133 from UniProt:P11362 FGFR1
Insertion of residues 429 to 822 at 133 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 133 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 133 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 133 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 133 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 133 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 133 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 133 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 133 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 133 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 133 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 133 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 133 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 164 from UniProt:P11362 FGFR1
Insertion of residues 429 to 822 at 164 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 164 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 164 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 164 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 164 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 164 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 164 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 164 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 164 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 164 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 164 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 164 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 164 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 164 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 164 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 1692 from UniProt:P11362 FGFR1
Insertion of residues 429 to 822 at 250 from UniProt:P11362 FGFR1
Insertion of residues 429 to 822 at 340 from UniProt:P11362 FGFR1
Insertion of residues 429 to 822 at 340 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 340 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 340 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 340 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 340 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 340 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 340 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 340 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 340 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 340 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 340 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 340 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 340 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 340 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 340 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 340 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 340 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 340 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 340 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 340 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 340 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 340 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 340 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 340 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 340 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 491 from UniProt:P11362 FGFR1
Insertion of residues 429 to 822 at 585 from UniProt:P11362 FGFR1
Insertion of residues 429 to 822 at 585 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 585 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 585 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 585 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 585 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 585 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 585 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 585 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 585 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 585 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 585 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 585 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 585 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 585 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 585 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 585 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 585 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 585 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 585 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 585 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 585 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 585 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 585 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 585 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 627 from UniProt:P11362 FGFR1
Insertion of residues 429 to 822 at 627 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 627 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 627 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 627 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 627 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 627 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 627 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 627 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 627 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 627 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 627 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 627 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 627 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 627 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 627 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 809 from UniProt:P11362 FGFR1
Insertion of residues 429 to 822 at 809 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 809 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 809 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 809 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 809 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 809 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 809 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 809 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 809 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 809 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 914 from UniProt:P11362 FGFR1
Insertion of residues 429 to 822 at 914 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 914 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 914 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 914 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 914 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 914 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 914 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 914 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 914 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 914 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 914 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 914 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 914 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 914 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 914 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 914 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 914 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 914 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 914 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 914 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 914 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 914 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 429 to 822 at 914 from UniProt:P11362 FGFR1 (in Homo sapiens)
Insertion of residues 739 to 744 at 739 from UniProt:P00533 EGFR
Insertion of residues 767 to 769 at 767 from UniProt:P00533 EGFR
Insertion of residues 771 to 773 at 771 from UniProt:P00533 EGFR
Insertion of residues 771 to 773 at 774 from UniProt:P00533 EGFR
L-alanine 1028 replaced with L-valine
L-alanine 126 replaced with L-valine
L-alanine 154 replaced with L-threonine
L-alanine 167 replaced with glycine
L-alanine 1701 replaced with L-proline
L-alanine 1701 replaced with L-proline (in Homo sapiens)
L-alanine 1701 replaced with L-proline (in Homo sapiens)
L-alanine 1701 replaced with L-proline (in Homo sapiens)
L-alanine 1701 replaced with L-proline (in Homo sapiens)
L-alanine 1701 replaced with L-proline (in Homo sapiens)
L-alanine 1701 replaced with L-proline (in Homo sapiens)
L-alanine 1701 replaced with L-proline (in Homo sapiens)
L-alanine 1701 replaced with L-proline (in Homo sapiens)
L-alanine 1701 replaced with L-proline (in Homo sapiens)
L-alanine 1701 replaced with L-proline (in Homo sapiens)
L-alanine 1701 replaced with L-proline (in Homo sapiens)
L-alanine 1701 replaced with L-proline (in Homo sapiens)
L-alanine 1701 replaced with L-proline (in Homo sapiens)
L-alanine 1701 replaced with L-proline (in Homo sapiens)
L-alanine 1701 replaced with L-proline (in Homo sapiens)
L-alanine 171 replaced with L-threonine
L-alanine 186 replaced with L-aspartic acid
L-alanine 216 replaced with L-proline
L-alanine 267 replaced with glycine
L-alanine 269 replaced with glycine
L-alanine 273 replaced with glycine
L-alanine 275 replaced with glycine
L-alanine 276 replaced with L-cysteine
L-alanine 289 replaced with L-aspartic acid
L-alanine 289 replaced with L-threonine
L-alanine 289 replaced with L-valine
L-alanine 294 replaced with L-proline
L-alanine 30 replaced with L-proline
L-alanine 30 replaced with L-proline (in Homo sapiens)
L-alanine 30 replaced with L-proline (in Homo sapiens)
L-alanine 30 replaced with L-proline (in Homo sapiens)
L-alanine 30 replaced with L-proline (in Homo sapiens)
L-alanine 30 replaced with L-proline (in Homo sapiens)
L-alanine 30 replaced with L-proline (in Homo sapiens)
L-alanine 30 replaced with L-proline (in Homo sapiens)
L-alanine 30 replaced with L-proline (in Homo sapiens)
L-alanine 30 replaced with L-proline (in Homo sapiens)
L-alanine 314 replaced with L-aspartic acid
L-alanine 314 replaced with L-serine
L-alanine 315 replaced with L-serine
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-serine (in Homo sapiens)
L-alanine 315 replaced with L-threonine
L-alanine 328 replaced with L-proline
L-alanine 328 replaced with L-proline (in Homo sapiens)
L-alanine 328 replaced with L-proline (in Homo sapiens)
L-alanine 328 replaced with L-proline (in Homo sapiens)
L-alanine 328 replaced with L-proline (in Homo sapiens)
L-alanine 328 replaced with L-proline (in Homo sapiens)
L-alanine 328 replaced with L-proline (in Homo sapiens)
L-alanine 328 replaced with L-proline (in Homo sapiens)
L-alanine 328 replaced with L-proline (in Homo sapiens)
L-alanine 328 replaced with L-proline (in Homo sapiens)
L-alanine 328 replaced with L-proline (in Homo sapiens)
L-alanine 328 replaced with L-proline (in Homo sapiens)
L-alanine 328 replaced with L-proline (in Homo sapiens)
L-alanine 328 replaced with L-proline (in Homo sapiens)
L-alanine 328 replaced with L-proline (in Homo sapiens)
L-alanine 328 replaced with L-proline (in Homo sapiens)
L-alanine 328 replaced with L-proline (in Homo sapiens)
L-alanine 328 replaced with L-proline (in Homo sapiens)
L-alanine 330 replaced with L-leucine
L-alanine 330 replaced with L-leucine (in Homo sapiens)
L-alanine 330 replaced with L-leucine (in Homo sapiens)
L-alanine 330 replaced with L-leucine (in Homo sapiens)
L-alanine 330 replaced with L-leucine (in Homo sapiens)
L-alanine 330 replaced with L-leucine (in Homo sapiens)
L-alanine 330 replaced with L-leucine (in Homo sapiens)
L-alanine 330 replaced with L-leucine (in Homo sapiens)
L-alanine 330 replaced with L-leucine (in Homo sapiens)
L-alanine 330 replaced with L-leucine (in Homo sapiens)
L-alanine 330 replaced with L-leucine (in Homo sapiens)
L-alanine 330 replaced with L-leucine (in Homo sapiens)
L-alanine 330 replaced with L-leucine (in Homo sapiens)
L-alanine 330 replaced with L-leucine (in Homo sapiens)
L-alanine 330 replaced with L-leucine (in Homo sapiens)
L-alanine 330 replaced with L-leucine (in Homo sapiens)
L-alanine 330 replaced with L-leucine (in Homo sapiens)
L-alanine 330 replaced with L-leucine (in Homo sapiens)
L-alanine 331 replaced with L-valine
L-alanine 333 replaced with L-valine
L-alanine 354 replaced with L-valine
L-alanine 355 replaced with L-lysine
L-alanine 355 replaced with L-lysine (in Homo sapiens)
L-alanine 355 replaced with L-lysine (in Homo sapiens)
L-alanine 355 replaced with L-lysine (in Homo sapiens)
L-alanine 355 replaced with L-lysine (in Homo sapiens)
L-alanine 355 replaced with L-lysine (in Homo sapiens)
L-alanine 355 replaced with L-lysine (in Homo sapiens)
L-alanine 355 replaced with L-lysine (in Homo sapiens)
L-alanine 355 replaced with L-lysine (in Homo sapiens)
L-alanine 355 replaced with L-lysine (in Homo sapiens)
L-alanine 355 replaced with L-lysine (in Homo sapiens)
L-alanine 355 replaced with L-lysine (in Homo sapiens)
L-alanine 355 replaced with L-lysine (in Homo sapiens)
L-alanine 355 replaced with L-lysine (in Homo sapiens)
L-alanine 355 replaced with L-lysine (in Homo sapiens)
L-alanine 355 replaced with L-lysine (in Homo sapiens)
L-alanine 355 replaced with L-lysine (in Homo sapiens)
L-alanine 355 replaced with L-lysine (in Homo sapiens)
L-alanine 373 replaced with L-threonine
L-alanine 376 replaced with L-aspartic acid
L-alanine 378 replaced with L-glutamic acid
L-alanine 383 replaced with L-threonine
L-alanine 391 replaced with L-glutamic acid
L-alanine 410 replaced with L-proline
L-alanine 615 replaced with L-threonine
L-alanine 750 replaced with L-proline
L-alanine 755 replaced with glycine
L-alanine 80 replaced with L-proline
L-alanine residue 354 replaced with L-threonine
L-alanine residue 354 replaced with L-threonine (in Homo sapiens)
L-alanine residue 354 replaced with L-threonine (in Homo sapiens)
L-alanine residue 354 replaced with L-threonine (in Homo sapiens)
L-alanine residue 354 replaced with L-threonine (in Homo sapiens)
L-alanine residue 354 replaced with L-threonine (in Homo sapiens)
L-alanine residue 354 replaced with L-threonine (in Homo sapiens)
L-alanine residue 354 replaced with L-threonine (in Homo sapiens)
L-alanine residue 354 replaced with L-threonine (in Homo sapiens)
L-alanine residue 354 replaced with L-threonine (in Homo sapiens)
L-alanine residue 354 replaced with L-threonine (in Homo sapiens)
L-alanine residue 354 replaced with L-threonine (in Homo sapiens)
L-alanine residue 354 replaced with L-threonine (in Homo sapiens)
L-alanine residue 354 replaced with L-threonine (in Homo sapiens)
L-alanine residue 354 replaced with L-threonine (in Homo sapiens)
L-alanine residue 354 replaced with L-threonine (in Homo sapiens)
L-alanine residue 354 replaced with L-threonine (in Homo sapiens)
L-alanine residue 354 replaced with L-threonine (in Homo sapiens)
L-alanine residue 354 replaced with L-threonine (in Homo sapiens)
L-alanine residue 406 replaced with L-threonine
L-alanine residue 406 replaced with L-threonine (in Homo sapiens)
L-alanine residue 406 replaced with L-threonine (in Homo sapiens)
L-alanine residue 406 replaced with L-threonine (in Homo sapiens)
L-alanine residue 406 replaced with L-threonine (in Homo sapiens)
L-alanine residue 406 replaced with L-threonine (in Homo sapiens)
L-alanine residue 406 replaced with L-threonine (in Homo sapiens)
L-alanine residue 406 replaced with L-threonine (in Homo sapiens)
L-alanine residue 406 replaced with L-threonine (in Homo sapiens)
L-alanine residue 406 replaced with L-threonine (in Homo sapiens)
L-alanine residue 406 replaced with L-threonine (in Homo sapiens)
L-alanine residue 406 replaced with L-threonine (in Homo sapiens)
L-alanine residue 406 replaced with L-threonine (in Homo sapiens)
L-alanine residue 406 replaced with L-threonine (in Homo sapiens)
L-alanine residue 406 replaced with L-threonine (in Homo sapiens)
L-alanine residue 406 replaced with L-threonine (in Homo sapiens)
L-alanine residue 406 replaced with L-threonine (in Homo sapiens)
L-alanine residue 406 replaced with L-threonine (in Homo sapiens)
L-alanine residue 406 replaced with L-threonine (in Homo sapiens)
L-alanine residue 406 replaced with L-threonine (in Homo sapiens)
L-arginine 104 replaced with unknown
L-arginine 107 replaced with L-glutamine
L-arginine 107 replaced with L-histidine
L-arginine 107 replaced with L-histidine
L-arginine 107 replaced with unknown
L-arginine 108 replaced with L-cysteine
L-arginine 108 replaced with L-lysine
L-arginine 111 replaced with unknown
L-arginine 125 replaced with L-cysteine
L-arginine 127 replaced with L-cysteine
L-arginine 130 replaced with glycine
L-arginine 130 replaced with glycine (in Homo sapiens)
L-arginine 130 replaced with glycine (in Homo sapiens)
L-arginine 130 replaced with glycine (in Homo sapiens)
L-arginine 130 replaced with glycine (in Homo sapiens)
L-arginine 130 replaced with glycine (in Homo sapiens)
L-arginine 130 replaced with glycine (in Homo sapiens)
L-arginine 130 replaced with glycine (in Homo sapiens)
L-arginine 130 replaced with glycine (in Homo sapiens)
L-arginine 130 replaced with glycine (in Homo sapiens)
L-arginine 130 replaced with glycine (in Homo sapiens)
L-arginine 130 replaced with glycine (in Homo sapiens)
L-arginine 130 replaced with glycine (in Homo sapiens)
L-arginine 130 replaced with glycine (in Homo sapiens)
L-arginine 130 replaced with glycine (in Homo sapiens)
L-arginine 130 replaced with glycine (in Homo sapiens)
L-arginine 130 replaced with glycine (in Homo sapiens)
L-arginine 130 replaced with glycine (in Homo sapiens)
L-arginine 130 replaced with glycine (in Homo sapiens)
L-arginine 130 replaced with glycine (in Homo sapiens)
L-arginine 130 replaced with glycine (in Homo sapiens)
L-arginine 130 replaced with glycine (in Homo sapiens)
L-arginine 130 replaced with glycine (in Homo sapiens)
L-arginine 130 replaced with glycine (in Homo sapiens)
L-arginine 130 replaced with glycine (in Homo sapiens)
L-arginine 130 replaced with glycine (in Homo sapiens)
L-arginine 130 replaced with glycine (in Homo sapiens)
L-arginine 130 replaced with glycine (in Homo sapiens)
L-arginine 130 replaced with L-glutamine
L-arginine 130 replaced with L-leucine
L-arginine 130 replaced with L-proline
L-arginine 130 replaced with unknown
L-arginine 132 replaced with L-cysteine
L-arginine 132 replaced with L-histidine
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-histidine (in Homo sapiens)
L-arginine 132 replaced with L-leucine
L-arginine 132 replaced with L-serine
L-arginine 132 replaced with unknown
L-arginine 135 replaced with glycine
L-arginine 145 replaced with unknown
L-arginine 1450 replaced with unknown
L-arginine 146 replaced with L-glutamine
L-arginine 157 replaced with L-tryptophan
L-arginine 159 replaced with L-glutamine
L-arginine 1598 replaced with L-proline
L-arginine 1598 replaced with L-proline (in Homo sapiens)
L-arginine 1598 replaced with L-proline (in Homo sapiens)
L-arginine 1598 replaced with L-proline (in Homo sapiens)
L-arginine 1598 replaced with L-proline (in Homo sapiens)
L-arginine 1598 replaced with L-proline (in Homo sapiens)
L-arginine 1598 replaced with L-proline (in Homo sapiens)
L-arginine 1598 replaced with L-proline (in Homo sapiens)
L-arginine 1598 replaced with L-proline (in Homo sapiens)
L-arginine 1598 replaced with L-proline (in Homo sapiens)
L-arginine 1598 replaced with L-proline (in Homo sapiens)
L-arginine 1598 replaced with L-proline (in Homo sapiens)
L-arginine 1598 replaced with L-proline (in Homo sapiens)
L-arginine 1598 replaced with L-proline (in Homo sapiens)
L-arginine 1598 replaced with L-proline (in Homo sapiens)
L-arginine 1598 replaced with L-proline (in Homo sapiens)
L-arginine 161 replaced with L-glutamine
L-arginine 164 replaced with L-glutamine
L-arginine 171 replaced with L-glutamine
L-arginine 173 replaced with L-cysteine
L-arginine 173 replaced with L-histidine
L-arginine 173 replaced with L-histidine (in Homo sapiens)
L-arginine 173 replaced with L-histidine (in Homo sapiens)
L-arginine 173 replaced with L-histidine (in Homo sapiens)
L-arginine 173 replaced with L-histidine (in Homo sapiens)
L-arginine 173 replaced with L-histidine (in Homo sapiens)
L-arginine 173 replaced with L-histidine (in Homo sapiens)
L-arginine 173 replaced with L-histidine (in Homo sapiens)
L-arginine 173 replaced with L-histidine (in Homo sapiens)
L-arginine 173 replaced with L-histidine (in Homo sapiens)
L-arginine 173 replaced with L-histidine (in Homo sapiens)
L-arginine 173 replaced with L-histidine (in Homo sapiens)
L-arginine 173 replaced with L-histidine (in Homo sapiens)
L-arginine 173 replaced with L-histidine (in Homo sapiens)
L-arginine 173 replaced with L-histidine (in Homo sapiens)
L-arginine 173 replaced with L-histidine (in Homo sapiens)
L-arginine 173 replaced with L-histidine (in Homo sapiens)
L-arginine 173 replaced with L-histidine (in Homo sapiens)
L-arginine 173 replaced with L-histidine (in Homo sapiens)
L-arginine 173 replaced with L-histidine (in Homo sapiens)
L-arginine 173 replaced with L-histidine (in Homo sapiens)
L-arginine 173 replaced with L-histidine (in Homo sapiens)
L-arginine 173 replaced with L-histidine (in Homo sapiens)
L-arginine 173 replaced with L-histidine (in Homo sapiens)
L-arginine 173 replaced with L-histidine (in Homo sapiens)
L-arginine 173 replaced with L-histidine (in Homo sapiens)
L-arginine 173 replaced with L-histidine (in Homo sapiens)
L-arginine 173 replaced with L-histidine (in Homo sapiens)
L-arginine 173 replaced with L-proline
L-arginine 178 replaced with unknown
L-arginine 181 replaced with L-tryptophan
L-arginine 186 replaced with L-tryptophan
L-arginine 191 replaced with L-tryptophan
L-arginine 197 replaced with L-tryptophan
L-arginine 211 replaced with L-tryptophan
L-arginine 213 replaced with L-proline
L-arginine 216 replaced with L-tryptophan
L-arginine 222 replaced with L-tryptophan
L-arginine 233 replaced with unknown
L-arginine 236 replaced with glycine
L-arginine 236 replaced with glycine (in Homo sapiens)
L-arginine 236 replaced with glycine (in Homo sapiens)
L-arginine 236 replaced with glycine (in Homo sapiens)
L-arginine 236 replaced with glycine (in Homo sapiens)
L-arginine 236 replaced with glycine (in Homo sapiens)
L-arginine 236 replaced with glycine (in Homo sapiens)
L-arginine 236 replaced with glycine (in Homo sapiens)
L-arginine 236 replaced with glycine (in Homo sapiens)
L-arginine 236 replaced with glycine (in Homo sapiens)
L-arginine 236 replaced with glycine (in Homo sapiens)
L-arginine 236 replaced with glycine (in Homo sapiens)
L-arginine 236 replaced with glycine (in Homo sapiens)
L-arginine 236 replaced with glycine (in Homo sapiens)
L-arginine 243 replaced with L-histidine
L-arginine 245 replaced with L-histidine
L-arginine 247 replaced with unknown
L-arginine 248 replaced with L-cysteine
L-arginine 248 replaced with L-cysteine (in Homo sapiens)
L-arginine 248 replaced with L-cysteine (in Homo sapiens)
L-arginine 248 replaced with L-cysteine (in Homo sapiens)
L-arginine 248 replaced with L-cysteine (in Homo sapiens)
L-arginine 248 replaced with L-cysteine (in Homo sapiens)
L-arginine 248 replaced with L-cysteine (in Homo sapiens)
L-arginine 248 replaced with L-cysteine (in Homo sapiens)
L-arginine 248 replaced with L-cysteine (in Homo sapiens)
L-arginine 248 replaced with L-cysteine (in Homo sapiens)
L-arginine 248 replaced with L-cysteine (in Homo sapiens)
L-arginine 248 replaced with L-cysteine (in Homo sapiens)
L-arginine 248 replaced with L-cysteine (in Homo sapiens)
L-arginine 248 replaced with L-cysteine (in Homo sapiens)
L-arginine 248 replaced with L-cysteine (in Homo sapiens)
L-arginine 248 replaced with L-cysteine (in Homo sapiens)
L-arginine 248 replaced with L-cysteine (in Homo sapiens)
L-arginine 248 replaced with L-cysteine (in Homo sapiens)
L-arginine 248 replaced with L-cysteine (in Homo sapiens)
L-arginine 248 replaced with L-cysteine (in Homo sapiens)
L-arginine 248 replaced with L-cysteine (in Homo sapiens)
L-arginine 248 replaced with L-cysteine (in Homo sapiens)
L-arginine 248 replaced with L-cysteine (in Homo sapiens)
L-arginine 248 replaced with L-cysteine (in Homo sapiens)
L-arginine 248 replaced with L-cysteine (in Homo sapiens)
L-arginine 248 replaced with L-cysteine (in Homo sapiens)
L-arginine 250 replaced with unknown
L-arginine 250 replaced with unknown (in Homo sapiens)
L-arginine 250 replaced with unknown (in Homo sapiens)
L-arginine 250 replaced with unknown (in Homo sapiens)
L-arginine 250 replaced with unknown (in Homo sapiens)
L-arginine 250 replaced with unknown (in Homo sapiens)
L-arginine 250 replaced with unknown (in Homo sapiens)
L-arginine 250 replaced with unknown (in Homo sapiens)
L-arginine 250 replaced with unknown (in Homo sapiens)
L-arginine 250 replaced with unknown (in Homo sapiens)
L-arginine 250 replaced with unknown (in Homo sapiens)
L-arginine 250 replaced with unknown (in Homo sapiens)
L-arginine 250 replaced with unknown (in Homo sapiens)
L-arginine 250 replaced with unknown (in Homo sapiens)
L-arginine 250 replaced with unknown (in Homo sapiens)
L-arginine 250 replaced with unknown (in Homo sapiens)
L-arginine 250 replaced with unknown (in Homo sapiens)
L-arginine 250 replaced with unknown (in Homo sapiens)
L-arginine 250 replaced with unknown (in Homo sapiens)
L-arginine 265 replaced with L-proline
L-arginine 267 replaced with L-tryptophan
L-arginine 270 replaced with L-cysteine
L-arginine 271 replaced with L-proline
L-arginine 276 replaced with L-tryptophan
L-arginine 277 replaced with L-glutamine
L-arginine 280 replaced with L-histidine
L-arginine 283 replaced with L-cysteine
L-arginine 297 replaced with glycine
L-arginine 297 replaced with glycine (in Homo sapiens)
L-arginine 297 replaced with glycine (in Homo sapiens)
L-arginine 297 replaced with glycine (in Homo sapiens)
L-arginine 297 replaced with glycine (in Homo sapiens)
L-arginine 297 replaced with glycine (in Homo sapiens)
L-arginine 297 replaced with glycine (in Homo sapiens)
L-arginine 297 replaced with glycine (in Homo sapiens)
L-arginine 297 replaced with glycine (in Homo sapiens)
L-arginine 297 replaced with glycine (in Homo sapiens)
L-arginine 297 replaced with glycine (in Homo sapiens)
L-arginine 297 replaced with glycine (in Homo sapiens)
L-arginine 297 replaced with glycine (in Homo sapiens)
L-arginine 297 replaced with glycine (in Homo sapiens)
L-arginine 297 replaced with glycine (in Homo sapiens)
L-arginine 297 replaced with glycine (in Homo sapiens)
L-arginine 297 replaced with glycine (in Homo sapiens)
L-arginine 297 replaced with unknown
L-arginine 304 replaced with L-glutamine
L-arginine 329 replaced with unknown
L-arginine 332 replaced with L-glutamic acid
L-arginine 332 replaced with L-glutamic acid (in Homo sapiens)
L-arginine 332 replaced with L-glutamic acid (in Homo sapiens)
L-arginine 332 replaced with L-glutamic acid (in Homo sapiens)
L-arginine 332 replaced with L-glutamic acid (in Homo sapiens)
L-arginine 332 replaced with L-glutamic acid (in Homo sapiens)
L-arginine 332 replaced with L-glutamic acid (in Homo sapiens)
L-arginine 332 replaced with L-glutamic acid (in Homo sapiens)
L-arginine 332 replaced with L-glutamic acid (in Homo sapiens)
L-arginine 332 replaced with L-glutamic acid (in Homo sapiens)
L-arginine 332 replaced with L-glutamic acid (in Homo sapiens)
L-arginine 332 replaced with L-glutamic acid (in Homo sapiens)
L-arginine 332 replaced with L-glutamic acid (in Homo sapiens)
L-arginine 332 replaced with L-glutamic acid (in Homo sapiens)
L-arginine 332 replaced with L-glutamic acid (in Homo sapiens)
L-arginine 332 replaced with L-glutamic acid (in Homo sapiens)
L-arginine 332 replaced with L-glutamic acid (in Homo sapiens)
L-arginine 332 replaced with L-glutamic acid (in Homo sapiens)
L-arginine 334 replaced with L-cysteine
L-arginine 335 replaced with L-proline
L-arginine 335 replaced with unknown
L-arginine 339 replaced with L-leucine
L-arginine 340 replaced with L-cysteine
L-arginine 341 replaced with unknown
L-arginine 344 replaced with L-cysteine
L-arginine 347 replaced with L-cysteine
L-arginine 347 replaced with L-histidine
L-arginine 347 replaced with L-histidine
L-arginine 353 replaced with L-cysteine
L-arginine 355 replaced with unknown
L-arginine 356 replaced with unknown
L-arginine 358 replaced with L-glutamine
L-arginine 358 replaced with unknown
L-arginine 358 replaced with unknown (in Homo sapiens)
L-arginine 358 replaced with unknown (in Homo sapiens)
L-arginine 358 replaced with unknown (in Homo sapiens)
L-arginine 358 replaced with unknown (in Homo sapiens)
L-arginine 358 replaced with unknown (in Homo sapiens)
L-arginine 358 replaced with unknown (in Homo sapiens)
L-arginine 361 replaced with L-glutamine
L-arginine 362 replaced with L-cysteine
L-arginine 363 replaced with L-leucine
L-arginine 365 replaced with L-glutamine
L-arginine 368 replaced with L-histidine
L-arginine 374 replaced with L-glutamine
L-arginine 375 replaced with L-cysteine
L-arginine 38 replaced with glycine
L-arginine 38 replaced with L-cysteine
L-arginine 38 replaced with L-histidine
L-arginine 38 replaced with L-histidine (in Homo sapiens)
L-arginine 38 replaced with L-histidine (in Homo sapiens)
L-arginine 38 replaced with L-histidine (in Homo sapiens)
L-arginine 38 replaced with L-histidine (in Homo sapiens)
L-arginine 38 replaced with L-histidine (in Homo sapiens)
L-arginine 38 replaced with L-histidine (in Homo sapiens)
L-arginine 38 replaced with L-histidine (in Homo sapiens)
L-arginine 38 replaced with L-histidine (in Homo sapiens)
L-arginine 38 replaced with L-histidine (in Homo sapiens)
L-arginine 38 replaced with L-histidine (in Homo sapiens)
L-arginine 38 replaced with L-histidine (in Homo sapiens)
L-arginine 38 replaced with L-histidine (in Homo sapiens)
L-arginine 38 replaced with L-histidine (in Homo sapiens)
L-arginine 38 replaced with L-serine
L-arginine 381 replaced with L-proline
L-arginine 384 replaced with unknown
L-arginine 386 replaced with L-cysteine
L-arginine 387 replaced with L-cysteine
L-arginine 387 replaced with L-leucine
L-arginine 388 replaced with unknown
L-arginine 389 replaced with glycine
L-arginine 389 replaced with L-histidine
L-arginine 390 replaced with L-histidine
L-arginine 393 replaced with L-histidine
L-arginine 396 replaced with L-tryptophan
L-arginine 397 replaced with L-tryptophan
L-arginine 413 replaced with L-glutamic acid
L-arginine 414 replaced with unknown
L-arginine 414 replaced with unknown (in Homo sapiens)
L-arginine 414 replaced with unknown (in Homo sapiens)
L-arginine 414 replaced with unknown (in Homo sapiens)
L-arginine 414 replaced with unknown (in Homo sapiens)
L-arginine 414 replaced with unknown (in Homo sapiens)
L-arginine 414 replaced with unknown (in Homo sapiens)
L-arginine 414 replaced with unknown (in Homo sapiens)
L-arginine 414 replaced with unknown (in Homo sapiens)
L-arginine 414 replaced with unknown (in Homo sapiens)
L-arginine 414 replaced with unknown (in Homo sapiens)
L-arginine 414 replaced with unknown (in Homo sapiens)
L-arginine 414 replaced with unknown (in Homo sapiens)
L-arginine 414 replaced with unknown (in Homo sapiens)
L-arginine 414 replaced with unknown (in Homo sapiens)
L-arginine 414 replaced with unknown (in Homo sapiens)
L-arginine 414 replaced with unknown (in Homo sapiens)
L-arginine 414 replaced with unknown (in Homo sapiens)
L-arginine 417 replaced with L-histidine
L-arginine 425 replaced with L-aspartic acid
L-arginine 443 replaced with unknown
L-arginine 448 replaced with L-cysteine
L-arginine 448 replaced with L-histidine
L-arginine 465 replaced with L-cysteine
L-arginine 465 replaced with L-cysteine (in Homo sapiens)
L-arginine 465 replaced with L-cysteine (in Homo sapiens)
L-arginine 465 replaced with L-cysteine (in Homo sapiens)
L-arginine 465 replaced with L-cysteine (in Homo sapiens)
L-arginine 465 replaced with L-cysteine (in Homo sapiens)
L-arginine 465 replaced with L-cysteine (in Homo sapiens)
L-arginine 465 replaced with L-cysteine (in Homo sapiens)
L-arginine 465 replaced with L-cysteine (in Homo sapiens)
L-arginine 465 replaced with L-cysteine (in Homo sapiens)
L-arginine 465 replaced with L-cysteine (in Homo sapiens)
L-arginine 465 replaced with L-cysteine (in Homo sapiens)
L-arginine 465 replaced with L-cysteine (in Homo sapiens)
L-arginine 465 replaced with L-cysteine (in Homo sapiens)
L-arginine 465 replaced with L-cysteine (in Homo sapiens)
L-arginine 465 replaced with L-histidine
L-arginine 468 replaced with L-glutamine
L-arginine 468 replaced with L-leucine
L-arginine 468 replaced with L-tryptophan
L-arginine 469 replaced with L-tryptophan
L-arginine 474 replaced with L-glutamine
L-arginine 474 replaced with L-tryptophan
L-arginine 478 replaced with L-histidine
L-arginine 479 replaced with L-glutamine
L-arginine 479 replaced with L-glutamine (in Homo sapiens)
L-arginine 479 replaced with L-glutamine (in Homo sapiens)
L-arginine 479 replaced with L-glutamine (in Homo sapiens)
L-arginine 479 replaced with L-glutamine (in Homo sapiens)
L-arginine 479 replaced with L-glutamine (in Homo sapiens)
L-arginine 479 replaced with L-glutamine (in Homo sapiens)
L-arginine 479 replaced with L-glutamine (in Homo sapiens)
L-arginine 479 replaced with L-glutamine (in Homo sapiens)
L-arginine 479 replaced with L-glutamine (in Homo sapiens)
L-arginine 479 replaced with L-glutamine (in Homo sapiens)
L-arginine 479 replaced with L-glutamine (in Homo sapiens)
L-arginine 479 replaced with L-glutamine (in Homo sapiens)
L-arginine 479 replaced with L-glutamine (in Homo sapiens)
L-arginine 479 replaced with L-glutamine (in Homo sapiens)
L-arginine 482 replaced with L-cysteine
L-arginine 486 replaced with L-threonine
L-arginine 488 replaced with L-tryptophan
L-arginine 492 replaced with L-tryptophan
L-arginine 505 replaced with L-cysteine
L-arginine 505 replaced with L-cysteine (in Homo sapiens)
L-arginine 505 replaced with L-cysteine (in Homo sapiens)
L-arginine 505 replaced with L-cysteine (in Homo sapiens)
L-arginine 505 replaced with L-cysteine (in Homo sapiens)
L-arginine 505 replaced with L-cysteine (in Homo sapiens)
L-arginine 505 replaced with L-cysteine (in Homo sapiens)
L-arginine 505 replaced with L-cysteine (in Homo sapiens)
L-arginine 505 replaced with L-cysteine (in Homo sapiens)
L-arginine 505 replaced with L-cysteine (in Homo sapiens)
L-arginine 505 replaced with L-cysteine (in Homo sapiens)
L-arginine 505 replaced with L-cysteine (in Homo sapiens)
L-arginine 505 replaced with L-cysteine (in Homo sapiens)
L-arginine 505 replaced with L-cysteine (in Homo sapiens)
L-arginine 505 replaced with L-cysteine (in Homo sapiens)
L-arginine 505 replaced with L-leucine
L-arginine 508 replaced with L-tryptophan
L-arginine 515 replaced with unknown
L-arginine 528 replaced with L-cysteine
L-arginine 528 replaced with L-histidine
L-arginine 528 replaced with L-histidine (in Homo sapiens)
L-arginine 528 replaced with L-histidine (in Homo sapiens)
L-arginine 528 replaced with L-histidine (in Homo sapiens)
L-arginine 528 replaced with L-histidine (in Homo sapiens)
L-arginine 528 replaced with L-histidine (in Homo sapiens)
L-arginine 528 replaced with L-histidine (in Homo sapiens)
L-arginine 528 replaced with L-histidine (in Homo sapiens)
L-arginine 528 replaced with L-histidine (in Homo sapiens)
L-arginine 528 replaced with L-histidine (in Homo sapiens)
L-arginine 528 replaced with L-histidine (in Homo sapiens)
L-arginine 528 replaced with L-histidine (in Homo sapiens)
L-arginine 538 replaced with L-cysteine
L-arginine 54 replaced with unknown
L-arginine 54 replaced with unknown (in Homo sapiens)
L-arginine 54 replaced with unknown (in Homo sapiens)
L-arginine 54 replaced with unknown (in Homo sapiens)
L-arginine 54 replaced with unknown (in Homo sapiens)
L-arginine 54 replaced with unknown (in Homo sapiens)
L-arginine 54 replaced with unknown (in Homo sapiens)
L-arginine 54 replaced with unknown (in Homo sapiens)
L-arginine 54 replaced with unknown (in Homo sapiens)
L-arginine 54 replaced with unknown (in Homo sapiens)
L-arginine 54 replaced with unknown (in Homo sapiens)
L-arginine 54 replaced with unknown (in Homo sapiens)
L-arginine 54 replaced with unknown (in Homo sapiens)
L-arginine 54 replaced with unknown (in Homo sapiens)
L-arginine 54 replaced with unknown (in Homo sapiens)
L-arginine 54 replaced with unknown (in Homo sapiens)
L-arginine 54 replaced with unknown (in Homo sapiens)
L-arginine 54 replaced with unknown (in Homo sapiens)
L-arginine 54 replaced with unknown (in Homo sapiens)
L-arginine 574 replaced with L-isoleucine
L-arginine 574 replaced with L-threonine
L-arginine 576 replaced with L-tryptophan
L-arginine 585 replaced with unknown
L-arginine 611 replaced with L-tryptophan
L-arginine 626 replaced with unknown
L-arginine 655 replaced with L-cysteine
L-arginine 655 replaced with L-cysteine (in Homo sapiens)
L-arginine 655 replaced with L-cysteine (in Homo sapiens)
L-arginine 655 replaced with L-cysteine (in Homo sapiens)
L-arginine 655 replaced with L-cysteine (in Homo sapiens)
L-arginine 655 replaced with L-cysteine (in Homo sapiens)
L-arginine 655 replaced with L-cysteine (in Homo sapiens)
L-arginine 655 replaced with L-cysteine (in Homo sapiens)
L-arginine 655 replaced with L-cysteine (in Homo sapiens)
L-arginine 655 replaced with L-cysteine (in Homo sapiens)
L-arginine 655 replaced with L-cysteine (in Homo sapiens)
L-arginine 655 replaced with L-cysteine (in Homo sapiens)
L-arginine 674 replaced with L-cysteine
L-arginine 674 replaced with L-histidine
L-arginine 74 replaced with L-cysteine
L-arginine 79 replaced with L-cysteine
L-arginine 943 replaced with L-glutamine
L-arginine 95 replaced with L-glutamine
L-arginine 96 replaced with L-glutamine
L-arginine 96 replaced with L-tryptophan
L-arginine residue 268 replaced with L-cysteine
L-arginine residue 268 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 268 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 268 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 268 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 268 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 268 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 268 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 268 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 268 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 268 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 268 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 268 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 268 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 268 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 268 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 268 replaced with L-histidine
L-arginine residue 361 replaced with glycine
L-arginine residue 361 replaced with L-cysteine
L-arginine residue 361 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 361 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 361 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 361 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 361 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 361 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 361 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 361 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 361 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 361 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 361 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 361 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 361 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 361 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 361 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 361 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 361 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 361 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 361 replaced with L-cysteine (in Homo sapiens)
L-arginine residue 361 replaced with L-histidine
L-arginine residue 361 replaced with L-serine
L-arginine residue 50 replaced with unknown
L-arginine residue 50 replaced with unknown (in Homo sapiens)
L-arginine residue 50 replaced with unknown (in Homo sapiens)
L-arginine residue 50 replaced with unknown (in Homo sapiens)
L-arginine residue 50 replaced with unknown (in Homo sapiens)
L-arginine residue 50 replaced with unknown (in Homo sapiens)
L-arginine residue 50 replaced with unknown (in Homo sapiens)
L-arginine residue 50 replaced with unknown (in Homo sapiens)
L-arginine residue 50 replaced with unknown (in Homo sapiens)
L-arginine residue 50 replaced with unknown (in Homo sapiens)
L-arginine residue 50 replaced with unknown (in Homo sapiens)
L-arginine residue 50 replaced with unknown (in Homo sapiens)
L-arginine residue 515 replaced with L-threonine
L-arginine residue 515 replaced with L-threonine (in Homo sapiens)
L-arginine residue 515 replaced with L-threonine (in Homo sapiens)
L-arginine residue 515 replaced with L-threonine (in Homo sapiens)
L-arginine residue 515 replaced with L-threonine (in Homo sapiens)
L-arginine residue 515 replaced with L-threonine (in Homo sapiens)
L-arginine residue 515 replaced with L-threonine (in Homo sapiens)
L-arginine residue 515 replaced with L-threonine (in Homo sapiens)
L-arginine residue 515 replaced with L-threonine (in Homo sapiens)
L-arginine residue 515 replaced with L-threonine (in Homo sapiens)
L-arginine residue 515 replaced with L-threonine (in Homo sapiens)
L-arginine residue 515 replaced with L-threonine (in Homo sapiens)
L-arginine residue 515 replaced with L-threonine (in Homo sapiens)
L-arginine residue 515 replaced with L-threonine (in Homo sapiens)
L-arginine residue 515 replaced with L-threonine (in Homo sapiens)
L-arginine residue 515 replaced with L-threonine (in Homo sapiens)
L-arginine residue 515 replaced with L-threonine (in Homo sapiens)
L-arginine residue 515 replaced with L-threonine (in Homo sapiens)
L-arginine residue 515 replaced with L-threonine (in Homo sapiens)
L-arginine residue 515 replaced with L-threonine (in Homo sapiens)
L-asparagine 110 replaced with glycine
L-asparagine 110 replaced with glycine (in Homo sapiens)
L-asparagine 110 replaced with glycine (in Homo sapiens)
L-asparagine 110 replaced with glycine (in Homo sapiens)
L-asparagine 110 replaced with glycine (in Homo sapiens)
L-asparagine 110 replaced with glycine (in Homo sapiens)
L-asparagine 110 replaced with glycine (in Homo sapiens)
L-asparagine 110 replaced with glycine (in Homo sapiens)
L-asparagine 110 replaced with glycine (in Homo sapiens)
L-asparagine 110 replaced with glycine (in Homo sapiens)
L-asparagine 110 replaced with glycine (in Homo sapiens)
L-asparagine 110 replaced with glycine (in Homo sapiens)
L-asparagine 110 replaced with glycine (in Homo sapiens)
L-asparagine 144 replaced with L-methionine
L-asparagine 144 replaced with L-methionine (in Homo sapiens)
L-asparagine 144 replaced with L-methionine (in Homo sapiens)
L-asparagine 144 replaced with L-methionine (in Homo sapiens)
L-asparagine 144 replaced with L-methionine (in Homo sapiens)
L-asparagine 144 replaced with L-methionine (in Homo sapiens)
L-asparagine 144 replaced with L-methionine (in Homo sapiens)
L-asparagine 144 replaced with L-methionine (in Homo sapiens)
L-asparagine 144 replaced with L-methionine (in Homo sapiens)
L-asparagine 146 replaced with L-threonine
L-asparagine 146 replaced with L-threonine (in Homo sapiens)
L-asparagine 146 replaced with L-threonine (in Homo sapiens)
L-asparagine 146 replaced with L-threonine (in Homo sapiens)
L-asparagine 146 replaced with L-threonine (in Homo sapiens)
L-asparagine 146 replaced with L-threonine (in Homo sapiens)
L-asparagine 146 replaced with L-threonine (in Homo sapiens)
L-asparagine 146 replaced with L-threonine (in Homo sapiens)
L-asparagine 146 replaced with L-threonine (in Homo sapiens)
L-asparagine 154 replaced with L-threonine
L-asparagine 154 replaced with L-threonine (in Homo sapiens)
L-asparagine 154 replaced with L-threonine (in Homo sapiens)
L-asparagine 154 replaced with L-threonine (in Homo sapiens)
L-asparagine 154 replaced with L-threonine (in Homo sapiens)
L-asparagine 154 replaced with L-threonine (in Homo sapiens)
L-asparagine 154 replaced with L-threonine (in Homo sapiens)
L-asparagine 154 replaced with L-threonine (in Homo sapiens)
L-asparagine 154 replaced with L-threonine (in Homo sapiens)
L-asparagine 157 replaced with L-isoleucine
L-asparagine 157 replaced with L-isoleucine (in Homo sapiens)
L-asparagine 157 replaced with L-isoleucine (in Homo sapiens)
L-asparagine 157 replaced with L-isoleucine (in Homo sapiens)
L-asparagine 157 replaced with L-isoleucine (in Homo sapiens)
L-asparagine 157 replaced with L-isoleucine (in Homo sapiens)
L-asparagine 157 replaced with L-isoleucine (in Homo sapiens)
L-asparagine 157 replaced with L-isoleucine (in Homo sapiens)
L-asparagine 157 replaced with L-isoleucine (in Homo sapiens)
L-asparagine 219 replaced with L-tyrosine
L-asparagine 27 replaced with L-lysine
L-asparagine 27 replaced with L-lysine (in Homo sapiens)
L-asparagine 27 replaced with L-lysine (in Homo sapiens)
L-asparagine 27 replaced with L-lysine (in Homo sapiens)
L-asparagine 27 replaced with L-lysine (in Homo sapiens)
L-asparagine 27 replaced with L-lysine (in Homo sapiens)
L-asparagine 27 replaced with L-lysine (in Homo sapiens)
L-asparagine 27 replaced with L-lysine (in Homo sapiens)
L-asparagine 27 replaced with L-lysine (in Homo sapiens)
L-asparagine 27 replaced with L-lysine (in Homo sapiens)
L-asparagine 27 replaced with L-lysine (in Homo sapiens)
L-asparagine 27 replaced with L-lysine (in Homo sapiens)
L-asparagine 27 replaced with L-lysine (in Homo sapiens)
L-asparagine 318 replaced with L-aspartic acid
L-asparagine 45 replaced with L-serine
L-asparagine 535 replaced with L-aspartic acid
L-asparagine 535 replaced with L-lysine
L-asparagine 535 replaced with L-lysine (in Homo sapiens)
L-asparagine 535 replaced with L-lysine (in Homo sapiens)
L-asparagine 535 replaced with L-lysine (in Homo sapiens)
L-asparagine 535 replaced with L-lysine (in Homo sapiens)
L-asparagine 535 replaced with L-lysine (in Homo sapiens)
L-asparagine 535 replaced with L-lysine (in Homo sapiens)
L-asparagine 535 replaced with L-lysine (in Homo sapiens)
L-asparagine 535 replaced with L-lysine (in Homo sapiens)
L-asparagine 535 replaced with L-lysine (in Homo sapiens)
L-asparagine 535 replaced with L-lysine (in Homo sapiens)
L-asparagine 535 replaced with L-lysine (in Homo sapiens)
L-asparagine 535 replaced with L-lysine (in Homo sapiens)
L-asparagine 535 replaced with L-lysine (in Homo sapiens)
L-asparagine 535 replaced with L-lysine (in Homo sapiens)
L-asparagine 535 replaced with L-lysine (in Homo sapiens)
L-asparagine 535 replaced with L-lysine (in Homo sapiens)
L-asparagine 535 replaced with L-lysine (in Homo sapiens)
L-asparagine 535 replaced with L-lysine (in Homo sapiens)
L-asparagine 535 replaced with L-lysine (in Homo sapiens)
L-asparagine 535 replaced with L-lysine (in Homo sapiens)
L-asparagine 535 replaced with L-lysine (in Homo sapiens)
L-asparagine 535 replaced with L-lysine (in Homo sapiens)
L-asparagine 546 replaced with L-lysine
L-asparagine 546 replaced with L-lysine (in Homo sapiens)
L-asparagine 546 replaced with L-lysine (in Homo sapiens)
L-asparagine 546 replaced with L-lysine (in Homo sapiens)
L-asparagine 546 replaced with L-lysine (in Homo sapiens)
L-asparagine 546 replaced with L-lysine (in Homo sapiens)
L-asparagine 546 replaced with L-lysine (in Homo sapiens)
L-asparagine 546 replaced with L-lysine (in Homo sapiens)
L-asparagine 546 replaced with L-lysine (in Homo sapiens)
L-asparagine 546 replaced with L-lysine (in Homo sapiens)
L-asparagine 546 replaced with L-lysine (in Homo sapiens)
L-asparagine 546 replaced with L-lysine (in Homo sapiens)
L-asparagine 546 replaced with L-lysine (in Homo sapiens)
L-asparagine 546 replaced with L-lysine (in Homo sapiens)
L-asparagine 546 replaced with L-lysine (in Homo sapiens)
L-asparagine 546 replaced with L-lysine (in Homo sapiens)
L-asparagine 546 replaced with L-lysine (in Homo sapiens)
L-asparagine 546 replaced with L-lysine (in Homo sapiens)
L-asparagine 546 replaced with L-lysine (in Homo sapiens)
L-asparagine 546 replaced with L-lysine (in Homo sapiens)
L-asparagine 546 replaced with L-lysine (in Homo sapiens)
L-asparagine 546 replaced with L-lysine (in Homo sapiens)
L-asparagine 546 replaced with L-lysine (in Homo sapiens)
L-asparagine 546 replaced with L-lysine (in Homo sapiens)
L-asparagine 546 replaced with L-lysine (in Homo sapiens)
L-asparagine 546 replaced with L-lysine (in Homo sapiens)
L-asparagine 546 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-histidine
L-asparagine 549 replaced with L-lysine
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 549 replaced with L-lysine (in Homo sapiens)
L-asparagine 564 replaced with L-aspartic acid
L-asparagine 564 replaced with L-aspartic acid (in Homo sapiens)
L-asparagine 564 replaced with L-aspartic acid (in Homo sapiens)
L-asparagine 564 replaced with L-aspartic acid (in Homo sapiens)
L-asparagine 564 replaced with L-aspartic acid (in Homo sapiens)
L-asparagine 564 replaced with L-aspartic acid (in Homo sapiens)
L-asparagine 564 replaced with L-aspartic acid (in Homo sapiens)
L-asparagine 564 replaced with L-aspartic acid (in Homo sapiens)
L-asparagine 564 replaced with L-aspartic acid (in Homo sapiens)
L-asparagine 564 replaced with L-aspartic acid (in Homo sapiens)
L-asparagine 564 replaced with L-aspartic acid (in Homo sapiens)
L-asparagine 564 replaced with L-aspartic acid (in Homo sapiens)
L-asparagine 564 replaced with L-aspartic acid (in Homo sapiens)
L-asparagine 564 replaced with L-aspartic acid (in Homo sapiens)
L-asparagine 564 replaced with L-aspartic acid (in Homo sapiens)
L-asparagine 564 replaced with L-aspartic acid (in Homo sapiens)
L-asparagine 564 replaced with L-aspartic acid (in Homo sapiens)
L-asparagine 564 replaced with L-aspartic acid (in Homo sapiens)
L-asparagine 564 replaced with L-aspartic acid (in Homo sapiens)
L-asparagine 564 replaced with L-aspartic acid (in Homo sapiens)
L-asparagine 564 replaced with L-aspartic acid (in Homo sapiens)
L-asparagine 564 replaced with L-aspartic acid (in Homo sapiens)
L-asparagine 564 replaced with L-aspartic acid (in Homo sapiens)
L-asparagine 564 replaced with L-lysine
L-asparagine 61 replaced with L-serine
L-asparagine 67 replaced with L-cysteine
L-aspartic acid 141 replaced with L-methionine
L-aspartic acid 141 replaced with L-methionine (in Homo sapiens)
L-aspartic acid 141 replaced with L-methionine (in Homo sapiens)
L-aspartic acid 141 replaced with L-methionine (in Homo sapiens)
L-aspartic acid 141 replaced with L-methionine (in Homo sapiens)
L-aspartic acid 141 replaced with L-methionine (in Homo sapiens)
L-aspartic acid 141 replaced with L-methionine (in Homo sapiens)
L-aspartic acid 141 replaced with L-methionine (in Homo sapiens)
L-aspartic acid 141 replaced with L-methionine (in Homo sapiens)
L-aspartic acid 145 replaced with L-threonine
L-aspartic acid 145 replaced with L-threonine (in Homo sapiens)
L-aspartic acid 145 replaced with L-threonine (in Homo sapiens)
L-aspartic acid 145 replaced with L-threonine (in Homo sapiens)
L-aspartic acid 145 replaced with L-threonine (in Homo sapiens)
L-aspartic acid 145 replaced with L-threonine (in Homo sapiens)
L-aspartic acid 145 replaced with L-threonine (in Homo sapiens)
L-aspartic acid 145 replaced with L-threonine (in Homo sapiens)
L-aspartic acid 145 replaced with L-threonine (in Homo sapiens)
L-aspartic acid 159 replaced with L-threonine
L-aspartic acid 159 replaced with L-threonine (in Homo sapiens)
L-aspartic acid 159 replaced with L-threonine (in Homo sapiens)
L-aspartic acid 159 replaced with L-threonine (in Homo sapiens)
L-aspartic acid 159 replaced with L-threonine (in Homo sapiens)
L-aspartic acid 159 replaced with L-threonine (in Homo sapiens)
L-aspartic acid 159 replaced with L-threonine (in Homo sapiens)
L-aspartic acid 159 replaced with L-threonine (in Homo sapiens)
L-aspartic acid 159 replaced with L-threonine (in Homo sapiens)
L-aspartic acid 203 replaced with L-glutamic acid
L-aspartic acid 227 replaced with L-asparagine
L-aspartic acid 316 replaced with L-valine
L-aspartic acid 333 replaced with L-isoleucine
L-aspartic acid 333 replaced with L-isoleucine (in Homo sapiens)
L-aspartic acid 333 replaced with L-isoleucine (in Homo sapiens)
L-aspartic acid 333 replaced with L-isoleucine (in Homo sapiens)
L-aspartic acid 333 replaced with L-isoleucine (in Homo sapiens)
L-aspartic acid 333 replaced with L-isoleucine (in Homo sapiens)
L-aspartic acid 333 replaced with L-isoleucine (in Homo sapiens)
L-aspartic acid 333 replaced with L-isoleucine (in Homo sapiens)
L-aspartic acid 333 replaced with L-isoleucine (in Homo sapiens)
L-aspartic acid 333 replaced with L-isoleucine (in Homo sapiens)
L-aspartic acid 333 replaced with L-isoleucine (in Homo sapiens)
L-aspartic acid 333 replaced with L-isoleucine (in Homo sapiens)
L-aspartic acid 333 replaced with L-isoleucine (in Homo sapiens)
L-aspartic acid 333 replaced with L-isoleucine (in Homo sapiens)
L-aspartic acid 333 replaced with L-isoleucine (in Homo sapiens)
L-aspartic acid 333 replaced with L-isoleucine (in Homo sapiens)
L-aspartic acid 333 replaced with L-isoleucine (in Homo sapiens)
L-aspartic acid 333 replaced with L-isoleucine (in Homo sapiens)
L-aspartic acid 423 replaced with L-alanine
L-aspartic acid 423 replaced with L-glutamic acid
L-aspartic acid 522 replaced with L-asparagine
L-aspartic acid 522 replaced with L-asparagine (in Homo sapiens)
L-aspartic acid 522 replaced with L-asparagine (in Homo sapiens)
L-aspartic acid 522 replaced with L-asparagine (in Homo sapiens)
L-aspartic acid 522 replaced with L-asparagine (in Homo sapiens)
L-aspartic acid 522 replaced with L-asparagine (in Homo sapiens)
L-aspartic acid 522 replaced with L-asparagine (in Homo sapiens)
L-aspartic acid 522 replaced with L-asparagine (in Homo sapiens)
L-aspartic acid 522 replaced with L-asparagine (in Homo sapiens)
L-aspartic acid 522 replaced with L-asparagine (in Homo sapiens)
L-aspartic acid 522 replaced with L-asparagine (in Homo sapiens)
L-aspartic acid 522 replaced with L-asparagine (in Homo sapiens)
L-aspartic acid 560 replaced with L-histidine
L-aspartic acid 560 replaced with L-tyrosine
L-aspartic acid 560 replaced with L-tyrosine (in Homo sapiens)
L-aspartic acid 560 replaced with L-tyrosine (in Homo sapiens)
L-aspartic acid 560 replaced with L-tyrosine (in Homo sapiens)
L-aspartic acid 560 replaced with L-tyrosine (in Homo sapiens)
L-aspartic acid 560 replaced with L-tyrosine (in Homo sapiens)
L-aspartic acid 560 replaced with L-tyrosine (in Homo sapiens)
L-aspartic acid 560 replaced with L-tyrosine (in Homo sapiens)
L-aspartic acid 560 replaced with L-tyrosine (in Homo sapiens)
L-aspartic acid 560 replaced with L-tyrosine (in Homo sapiens)
L-aspartic acid 560 replaced with L-tyrosine (in Homo sapiens)
L-aspartic acid 560 replaced with L-tyrosine (in Homo sapiens)
L-aspartic acid 560 replaced with L-tyrosine (in Homo sapiens)
L-aspartic acid 560 replaced with L-tyrosine (in Homo sapiens)
L-aspartic acid 560 replaced with L-tyrosine (in Homo sapiens)
L-aspartic acid 560 replaced with L-tyrosine (in Homo sapiens)
L-aspartic acid 560 replaced with L-tyrosine (in Homo sapiens)
L-aspartic acid 560 replaced with L-tyrosine (in Homo sapiens)
L-aspartic acid 560 replaced with L-tyrosine (in Homo sapiens)
L-aspartic acid 560 replaced with L-tyrosine (in Homo sapiens)
L-aspartic acid 560 replaced with L-tyrosine (in Homo sapiens)
L-aspartic acid 560 replaced with L-tyrosine (in Homo sapiens)
L-aspartic acid 560 replaced with L-tyrosine (in Homo sapiens)
L-aspartic acid 571 replaced with L-asparagine
L-aspartic acid residue 258 replaced with L-asparagine
L-aspartic acid residue 258 replaced with L-asparagine (in Homo sapiens)
L-aspartic acid residue 258 replaced with L-asparagine (in Homo sapiens)
L-aspartic acid residue 258 replaced with L-asparagine (in Homo sapiens)
L-aspartic acid residue 258 replaced with L-asparagine (in Homo sapiens)
L-aspartic acid residue 258 replaced with L-asparagine (in Homo sapiens)
L-aspartic acid residue 258 replaced with L-asparagine (in Homo sapiens)
L-aspartic acid residue 258 replaced with L-asparagine (in Homo sapiens)
L-aspartic acid residue 258 replaced with L-asparagine (in Homo sapiens)
L-aspartic acid residue 258 replaced with L-asparagine (in Homo sapiens)
L-aspartic acid residue 258 replaced with L-asparagine (in Homo sapiens)
L-aspartic acid residue 258 replaced with L-asparagine (in Homo sapiens)
L-aspartic acid residue 258 replaced with L-asparagine (in Homo sapiens)
L-aspartic acid residue 258 replaced with L-asparagine (in Homo sapiens)
L-aspartic acid residue 258 replaced with L-asparagine (in Homo sapiens)
L-aspartic acid residue 258 replaced with L-asparagine (in Homo sapiens)
L-aspartic acid residue 300 replaced with L-alanine
L-aspartic acid residue 300 replaced with L-alanine (in Homo sapiens)
L-aspartic acid residue 300 replaced with L-alanine (in Homo sapiens)
L-aspartic acid residue 300 replaced with L-alanine (in Homo sapiens)
L-aspartic acid residue 300 replaced with L-alanine (in Homo sapiens)
L-aspartic acid residue 300 replaced with L-alanine (in Homo sapiens)
L-aspartic acid residue 300 replaced with L-alanine (in Homo sapiens)
L-aspartic acid residue 300 replaced with L-alanine (in Homo sapiens)
L-aspartic acid residue 300 replaced with L-alanine (in Homo sapiens)
L-aspartic acid residue 300 replaced with L-alanine (in Homo sapiens)
L-aspartic acid residue 300 replaced with L-alanine (in Homo sapiens)
L-aspartic acid residue 300 replaced with L-alanine (in Homo sapiens)
L-aspartic acid residue 300 replaced with L-alanine (in Homo sapiens)
L-aspartic acid residue 300 replaced with L-alanine (in Homo sapiens)
L-aspartic acid residue 300 replaced with L-alanine (in Homo sapiens)
L-aspartic acid residue 300 replaced with L-alanine (in Homo sapiens)
L-aspartic acid residue 300 replaced with L-alanine (in Homo sapiens)
L-aspartic acid residue 300 replaced with L-alanine (in Homo sapiens)
L-aspartic acid residue 300 replaced with L-alanine (in Homo sapiens)
L-aspartic acid residue 300 replaced with L-asparagine
L-aspartic acid residue 300 replaced with L-valine
L-aspartic acid residue 351 replaced with glycine
L-aspartic acid residue 351 replaced with glycine (in Homo sapiens)
L-aspartic acid residue 351 replaced with glycine (in Homo sapiens)
L-aspartic acid residue 351 replaced with glycine (in Homo sapiens)
L-aspartic acid residue 351 replaced with glycine (in Homo sapiens)
L-aspartic acid residue 351 replaced with glycine (in Homo sapiens)
L-aspartic acid residue 351 replaced with glycine (in Homo sapiens)
L-aspartic acid residue 351 replaced with glycine (in Homo sapiens)
L-aspartic acid residue 351 replaced with glycine (in Homo sapiens)
L-aspartic acid residue 351 replaced with glycine (in Homo sapiens)
L-aspartic acid residue 351 replaced with glycine (in Homo sapiens)
L-aspartic acid residue 351 replaced with glycine (in Homo sapiens)
L-aspartic acid residue 351 replaced with glycine (in Homo sapiens)
L-aspartic acid residue 351 replaced with glycine (in Homo sapiens)
L-aspartic acid residue 351 replaced with glycine (in Homo sapiens)
L-aspartic acid residue 351 replaced with glycine (in Homo sapiens)
L-aspartic acid residue 351 replaced with glycine (in Homo sapiens)
L-aspartic acid residue 351 replaced with glycine (in Homo sapiens)
L-aspartic acid residue 351 replaced with glycine (in Homo sapiens)
L-aspartic acid residue 351 replaced with glycine (in Homo sapiens)
L-aspartic acid residue 351 replaced with L-histidine
L-aspartic acid residue 351 replaced with L-tyrosine
L-cysteine 102 replaced with glycine
L-cysteine 117 replaced with L-arginine
L-cysteine 124 replaced with L-arginine
L-cysteine 124 replaced with L-phenylalanine
L-cysteine 124 replaced with L-serine
L-cysteine 124 replaced with L-serine (in Homo sapiens)
L-cysteine 124 replaced with L-serine (in Homo sapiens)
L-cysteine 124 replaced with L-serine (in Homo sapiens)
L-cysteine 124 replaced with L-serine (in Homo sapiens)
L-cysteine 124 replaced with L-serine (in Homo sapiens)
L-cysteine 124 replaced with L-serine (in Homo sapiens)
L-cysteine 124 replaced with L-serine (in Homo sapiens)
L-cysteine 124 replaced with L-serine (in Homo sapiens)
L-cysteine 124 replaced with L-serine (in Homo sapiens)
L-cysteine 124 replaced with L-serine (in Homo sapiens)
L-cysteine 124 replaced with L-serine (in Homo sapiens)
L-cysteine 124 replaced with L-serine (in Homo sapiens)
L-cysteine 124 replaced with L-serine (in Homo sapiens)
L-cysteine 124 replaced with L-serine (in Homo sapiens)
L-cysteine 124 replaced with L-serine (in Homo sapiens)
L-cysteine 124 replaced with L-serine (in Homo sapiens)
L-cysteine 124 replaced with L-serine (in Homo sapiens)
L-cysteine 124 replaced with L-serine (in Homo sapiens)
L-cysteine 124 replaced with L-serine (in Homo sapiens)
L-cysteine 124 replaced with L-serine (in Homo sapiens)
L-cysteine 124 replaced with L-serine (in Homo sapiens)
L-cysteine 124 replaced with L-serine (in Homo sapiens)
L-cysteine 124 replaced with L-serine (in Homo sapiens)
L-cysteine 124 replaced with L-serine (in Homo sapiens)
L-cysteine 124 replaced with L-serine (in Homo sapiens)
L-cysteine 124 replaced with L-serine (in Homo sapiens)
L-cysteine 124 replaced with L-serine (in Homo sapiens)
L-cysteine 124 replaced with L-tyrosine
L-cysteine 136 replaced with L-valine
L-cysteine 136 replaced with L-valine (in Homo sapiens)
L-cysteine 136 replaced with L-valine (in Homo sapiens)
L-cysteine 136 replaced with L-valine (in Homo sapiens)
L-cysteine 136 replaced with L-valine (in Homo sapiens)
L-cysteine 136 replaced with L-valine (in Homo sapiens)
L-cysteine 136 replaced with L-valine (in Homo sapiens)
L-cysteine 136 replaced with L-valine (in Homo sapiens)
L-cysteine 136 replaced with L-valine (in Homo sapiens)
L-cysteine 138 replaced with L-valine
L-cysteine 138 replaced with L-valine (in Homo sapiens)
L-cysteine 138 replaced with L-valine (in Homo sapiens)
L-cysteine 138 replaced with L-valine (in Homo sapiens)
L-cysteine 138 replaced with L-valine (in Homo sapiens)
L-cysteine 138 replaced with L-valine (in Homo sapiens)
L-cysteine 138 replaced with L-valine (in Homo sapiens)
L-cysteine 138 replaced with L-valine (in Homo sapiens)
L-cysteine 138 replaced with L-valine (in Homo sapiens)
L-cysteine 143 replaced with L-alanine
L-cysteine 143 replaced with L-alanine (in Homo sapiens)
L-cysteine 143 replaced with L-alanine (in Homo sapiens)
L-cysteine 143 replaced with L-alanine (in Homo sapiens)
L-cysteine 143 replaced with L-alanine (in Homo sapiens)
L-cysteine 143 replaced with L-alanine (in Homo sapiens)
L-cysteine 143 replaced with L-alanine (in Homo sapiens)
L-cysteine 143 replaced with L-alanine (in Homo sapiens)
L-cysteine 143 replaced with L-alanine (in Homo sapiens)
L-cysteine 198 replaced with L-phenylalanine
L-cysteine 198 replaced with L-serine
L-cysteine 198 replaced with L-serine (in Homo sapiens)
L-cysteine 198 replaced with L-serine (in Homo sapiens)
L-cysteine 198 replaced with L-serine (in Homo sapiens)
L-cysteine 198 replaced with L-serine (in Homo sapiens)
L-cysteine 198 replaced with L-serine (in Homo sapiens)
L-cysteine 198 replaced with L-serine (in Homo sapiens)
L-cysteine 198 replaced with L-serine (in Homo sapiens)
L-cysteine 198 replaced with L-serine (in Homo sapiens)
L-cysteine 198 replaced with L-serine (in Homo sapiens)
L-cysteine 198 replaced with L-serine (in Homo sapiens)
L-cysteine 198 replaced with L-serine (in Homo sapiens)
L-cysteine 198 replaced with L-serine (in Homo sapiens)
L-cysteine 198 replaced with L-serine (in Homo sapiens)
L-cysteine 198 replaced with L-serine (in Homo sapiens)
L-cysteine 203 replaced with L-arginine
L-cysteine 203 replaced with L-arginine
L-cysteine 26 replaced with L-serine
L-cysteine 262 replaced with L-arginine
L-cysteine 289 replaced with L-serine
L-cysteine 339 replaced with unknown
L-cysteine 396 replaced with unknown
L-cysteine 41 replaced with L-tyrosine
L-cysteine 437 replaced with L-tyrosine
L-glutamic acid 1204 replaced with unknown
L-glutamic acid 131 replaced with L-arginine
L-glutamic acid 131 replaced with L-arginine (in Homo sapiens)
L-glutamic acid 131 replaced with L-arginine (in Homo sapiens)
L-glutamic acid 131 replaced with L-arginine (in Homo sapiens)
L-glutamic acid 131 replaced with L-arginine (in Homo sapiens)
L-glutamic acid 131 replaced with L-arginine (in Homo sapiens)
L-glutamic acid 131 replaced with L-arginine (in Homo sapiens)
L-glutamic acid 131 replaced with L-arginine (in Homo sapiens)
L-glutamic acid 131 replaced with L-arginine (in Homo sapiens)
L-glutamic acid 142 replaced with L-serine
L-glutamic acid 142 replaced with L-serine (in Homo sapiens)
L-glutamic acid 142 replaced with L-serine (in Homo sapiens)
L-glutamic acid 142 replaced with L-serine (in Homo sapiens)
L-glutamic acid 142 replaced with L-serine (in Homo sapiens)
L-glutamic acid 142 replaced with L-serine (in Homo sapiens)
L-glutamic acid 142 replaced with L-serine (in Homo sapiens)
L-glutamic acid 142 replaced with L-serine (in Homo sapiens)
L-glutamic acid 142 replaced with L-serine (in Homo sapiens)
L-glutamic acid 151 replaced with L-lysine
L-glutamic acid 151 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 151 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 151 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 151 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 151 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 151 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 151 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 151 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 152 replaced with L-asparagine
L-glutamic acid 152 replaced with L-asparagine (in Homo sapiens)
L-glutamic acid 152 replaced with L-asparagine (in Homo sapiens)
L-glutamic acid 152 replaced with L-asparagine (in Homo sapiens)
L-glutamic acid 152 replaced with L-asparagine (in Homo sapiens)
L-glutamic acid 152 replaced with L-asparagine (in Homo sapiens)
L-glutamic acid 152 replaced with L-asparagine (in Homo sapiens)
L-glutamic acid 152 replaced with L-asparagine (in Homo sapiens)
L-glutamic acid 152 replaced with L-asparagine (in Homo sapiens)
L-glutamic acid 1554 replaced with unknown
L-glutamic acid 1554 replaced with unknown (in Homo sapiens)
L-glutamic acid 1554 replaced with unknown (in Homo sapiens)
L-glutamic acid 1554 replaced with unknown (in Homo sapiens)
L-glutamic acid 1554 replaced with unknown (in Homo sapiens)
L-glutamic acid 1554 replaced with unknown (in Homo sapiens)
L-glutamic acid 1554 replaced with unknown (in Homo sapiens)
L-glutamic acid 1554 replaced with unknown (in Homo sapiens)
L-glutamic acid 1554 replaced with unknown (in Homo sapiens)
L-glutamic acid 1554 replaced with unknown (in Homo sapiens)
L-glutamic acid 1554 replaced with unknown (in Homo sapiens)
L-glutamic acid 1554 replaced with unknown (in Homo sapiens)
L-glutamic acid 1554 replaced with unknown (in Homo sapiens)
L-glutamic acid 1554 replaced with unknown (in Homo sapiens)
L-glutamic acid 1554 replaced with unknown (in Homo sapiens)
L-glutamic acid 1554 replaced with unknown (in Homo sapiens)
L-glutamic acid 1554 replaced with unknown (in Homo sapiens)
L-glutamic acid 1554 replaced with unknown (in Homo sapiens)
L-glutamic acid 1554 replaced with unknown (in Homo sapiens)
L-glutamic acid 1554 replaced with unknown (in Homo sapiens)
L-glutamic acid 1554 replaced with unknown (in Homo sapiens)
L-glutamic acid 1554 replaced with unknown (in Homo sapiens)
L-glutamic acid 1554 replaced with unknown (in Homo sapiens)
L-glutamic acid 1554 replaced with unknown (in Homo sapiens)
L-glutamic acid 17 replaced with L-lysine
L-glutamic acid 17 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 17 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 17 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 17 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 17 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 17 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 17 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 17 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 17 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 17 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 174 replaced with unknown
L-glutamic acid 174 replaced with unknown (in Homo sapiens)
L-glutamic acid 174 replaced with unknown (in Homo sapiens)
L-glutamic acid 174 replaced with unknown (in Homo sapiens)
L-glutamic acid 174 replaced with unknown (in Homo sapiens)
L-glutamic acid 174 replaced with unknown (in Homo sapiens)
L-glutamic acid 174 replaced with unknown (in Homo sapiens)
L-glutamic acid 174 replaced with unknown (in Homo sapiens)
L-glutamic acid 193 replaced with L-leucine
L-glutamic acid 210 replaced with L-lysine
L-glutamic acid 233 replaced with L-aspartic acid
L-glutamic acid 2515 replaced with L-valine
L-glutamic acid 2515 replaced with L-valine (in Homo sapiens)
L-glutamic acid 2515 replaced with L-valine (in Homo sapiens)
L-glutamic acid 2515 replaced with L-valine (in Homo sapiens)
L-glutamic acid 2515 replaced with L-valine (in Homo sapiens)
L-glutamic acid 2515 replaced with L-valine (in Homo sapiens)
L-glutamic acid 2515 replaced with L-valine (in Homo sapiens)
L-glutamic acid 2515 replaced with L-valine (in Homo sapiens)
L-glutamic acid 2515 replaced with L-valine (in Homo sapiens)
L-glutamic acid 2515 replaced with L-valine (in Homo sapiens)
L-glutamic acid 2515 replaced with L-valine (in Homo sapiens)
L-glutamic acid 2515 replaced with L-valine (in Homo sapiens)
L-glutamic acid 2515 replaced with L-valine (in Homo sapiens)
L-glutamic acid 2515 replaced with L-valine (in Homo sapiens)
L-glutamic acid 2515 replaced with L-valine (in Homo sapiens)
L-glutamic acid 2515 replaced with L-valine (in Homo sapiens)
L-glutamic acid 255 replaced with unknown
L-glutamic acid 268 replaced with L-lysine
L-glutamic acid 274 replaced with L-lysine
L-glutamic acid 32 replaced with L-lysine
L-glutamic acid 322 replaced with L-lysine
L-glutamic acid 33 replaced with L-serine
L-glutamic acid 342 replaced with L-proline
L-glutamic acid 371 replaced with glycine
L-glutamic acid 372 replaced with L-lysine
L-glutamic acid 380 replaced with glycine
L-glutamic acid 380 replaced with L-aspartic acid
L-glutamic acid 387 replaced with L-lysine
L-glutamic acid 397 replaced with L-lysine
L-glutamic acid 398 replaced with L-lysine
L-glutamic acid 406 replaced with unknown
L-glutamic acid 523 replaced with L-lysine
L-glutamic acid 526 replaced with L-glutamine
L-glutamic acid 526 replaced with L-glutamine (in Homo sapiens)
L-glutamic acid 526 replaced with L-glutamine (in Homo sapiens)
L-glutamic acid 526 replaced with L-glutamine (in Homo sapiens)
L-glutamic acid 526 replaced with L-glutamine (in Homo sapiens)
L-glutamic acid 526 replaced with L-glutamine (in Homo sapiens)
L-glutamic acid 526 replaced with L-glutamine (in Homo sapiens)
L-glutamic acid 526 replaced with L-glutamine (in Homo sapiens)
L-glutamic acid 526 replaced with L-glutamine (in Homo sapiens)
L-glutamic acid 526 replaced with L-glutamine (in Homo sapiens)
L-glutamic acid 526 replaced with L-glutamine (in Homo sapiens)
L-glutamic acid 526 replaced with L-glutamine (in Homo sapiens)
L-glutamic acid 542 replaced with L-glutamine
L-glutamic acid 542 replaced with L-lysine
L-glutamic acid 542 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 542 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 542 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 542 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 542 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 542 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 542 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 542 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 542 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 542 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 542 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 542 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 542 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 542 replaced with L-valine
L-glutamic acid 545 replaced with glycine
L-glutamic acid 545 replaced with L-alanine
L-glutamic acid 545 replaced with L-glutamine
L-glutamic acid 545 replaced with L-lysine
L-glutamic acid 545 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 545 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 545 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 545 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 545 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 545 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 545 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 545 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 545 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 545 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 545 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 545 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 545 replaced with L-lysine (in Homo sapiens)
L-glutamic acid 545 replaced with L-valine
L-glutamic acid 79 replaced with unknown
L-glutamic acid 79 replaced with unknown (in Homo sapiens)
L-glutamic acid 79 replaced with unknown (in Homo sapiens)
L-glutamic acid 79 replaced with unknown (in Homo sapiens)
L-glutamic acid 79 replaced with unknown (in Homo sapiens)
L-glutamic acid 79 replaced with unknown (in Homo sapiens)
L-glutamic acid 79 replaced with unknown (in Homo sapiens)
L-glutamic acid 79 replaced with unknown (in Homo sapiens)
L-glutamic acid 79 replaced with unknown (in Homo sapiens)
L-glutamic acid 79 replaced with unknown (in Homo sapiens)
L-glutamic acid 79 replaced with unknown (in Homo sapiens)
L-glutamic acid 79 replaced with unknown (in Homo sapiens)
L-glutamic acid 79 replaced with unknown (in Homo sapiens)
L-glutamic acid 79 replaced with unknown (in Homo sapiens)
L-glutamic acid 88 replaced with unknown
L-glutamine 1338 replaced with unknown
L-glutamine 1338 replaced with unknown (in Homo sapiens)
L-glutamine 1338 replaced with unknown (in Homo sapiens)
L-glutamine 1338 replaced with unknown (in Homo sapiens)
L-glutamine 1338 replaced with unknown (in Homo sapiens)
L-glutamine 1338 replaced with unknown (in Homo sapiens)
L-glutamine 1338 replaced with unknown (in Homo sapiens)
L-glutamine 1338 replaced with unknown (in Homo sapiens)
L-glutamine 1338 replaced with unknown (in Homo sapiens)
L-glutamine 1338 replaced with unknown (in Homo sapiens)
L-glutamine 1338 replaced with unknown (in Homo sapiens)
L-glutamine 1338 replaced with unknown (in Homo sapiens)
L-glutamine 1338 replaced with unknown (in Homo sapiens)
L-glutamine 1338 replaced with unknown (in Homo sapiens)
L-glutamine 1338 replaced with unknown (in Homo sapiens)
L-glutamine 1338 replaced with unknown (in Homo sapiens)
L-glutamine 1338 replaced with unknown (in Homo sapiens)
L-glutamine 1338 replaced with unknown (in Homo sapiens)
L-glutamine 1338 replaced with unknown (in Homo sapiens)
L-glutamine 1338 replaced with unknown (in Homo sapiens)
L-glutamine 1338 replaced with unknown (in Homo sapiens)
L-glutamine 1338 replaced with unknown (in Homo sapiens)
L-glutamine 1338 replaced with unknown (in Homo sapiens)
L-glutamine 1338 replaced with unknown (in Homo sapiens)
L-glutamine 17 replaced with unknown
L-glutamine 189 replaced with unknown
L-glutamine 2395 replaced with unknown
L-glutamine 2395 replaced with unknown (in Homo sapiens)
L-glutamine 2395 replaced with unknown (in Homo sapiens)
L-glutamine 2395 replaced with unknown (in Homo sapiens)
L-glutamine 2395 replaced with unknown (in Homo sapiens)
L-glutamine 2395 replaced with unknown (in Homo sapiens)
L-glutamine 2395 replaced with unknown (in Homo sapiens)
L-glutamine 2395 replaced with unknown (in Homo sapiens)
L-glutamine 2395 replaced with unknown (in Homo sapiens)
L-glutamine 2395 replaced with unknown (in Homo sapiens)
L-glutamine 2395 replaced with unknown (in Homo sapiens)
L-glutamine 2395 replaced with unknown (in Homo sapiens)
L-glutamine 2395 replaced with unknown (in Homo sapiens)
L-glutamine 2395 replaced with unknown (in Homo sapiens)
L-glutamine 2395 replaced with unknown (in Homo sapiens)
L-glutamine 2395 replaced with unknown (in Homo sapiens)
L-glutamine 2403 replaced with unknown
L-glutamine 2403 replaced with unknown (in Homo sapiens)
L-glutamine 2403 replaced with unknown (in Homo sapiens)
L-glutamine 2403 replaced with unknown (in Homo sapiens)
L-glutamine 2403 replaced with unknown (in Homo sapiens)
L-glutamine 2403 replaced with unknown (in Homo sapiens)
L-glutamine 2403 replaced with unknown (in Homo sapiens)
L-glutamine 2403 replaced with unknown (in Homo sapiens)
L-glutamine 2403 replaced with unknown (in Homo sapiens)
L-glutamine 2403 replaced with unknown (in Homo sapiens)
L-glutamine 2403 replaced with unknown (in Homo sapiens)
L-glutamine 2403 replaced with unknown (in Homo sapiens)
L-glutamine 2403 replaced with unknown (in Homo sapiens)
L-glutamine 2403 replaced with unknown (in Homo sapiens)
L-glutamine 2403 replaced with unknown (in Homo sapiens)
L-glutamine 2403 replaced with unknown (in Homo sapiens)
L-glutamine 2440 replaced with unknown
L-glutamine 2440 replaced with unknown (in Homo sapiens)
L-glutamine 2440 replaced with unknown (in Homo sapiens)
L-glutamine 2440 replaced with unknown (in Homo sapiens)
L-glutamine 2440 replaced with unknown (in Homo sapiens)
L-glutamine 2440 replaced with unknown (in Homo sapiens)
L-glutamine 2440 replaced with unknown (in Homo sapiens)
L-glutamine 2440 replaced with unknown (in Homo sapiens)
L-glutamine 2440 replaced with unknown (in Homo sapiens)
L-glutamine 2440 replaced with unknown (in Homo sapiens)
L-glutamine 2440 replaced with unknown (in Homo sapiens)
L-glutamine 2440 replaced with unknown (in Homo sapiens)
L-glutamine 2440 replaced with unknown (in Homo sapiens)
L-glutamine 2440 replaced with unknown (in Homo sapiens)
L-glutamine 2440 replaced with unknown (in Homo sapiens)
L-glutamine 2440 replaced with unknown (in Homo sapiens)
L-glutamine 258 replaced with unknown
L-glutamine 263 replaced with L-arginine
L-glutamine 272 replaced with unknown
L-glutamine 296 replaced with unknown
L-glutamine 318 replaced with L-proline
L-glutamine 318 replaced with unknown
L-glutamine 331 replaced with unknown
L-glutamine 390 replaced with unknown
L-glutamine 456 replaced with L-histidine
L-glutamine 546 replaced with L-arginine
L-glutamine 546 replaced with L-glutamic acid
L-glutamine 546 replaced with L-histidine
L-glutamine 546 replaced with L-leucine
L-glutamine 546 replaced with L-lysine
L-glutamine 546 replaced with L-lysine (in Homo sapiens)
L-glutamine 546 replaced with L-lysine (in Homo sapiens)
L-glutamine 546 replaced with L-lysine (in Homo sapiens)
L-glutamine 546 replaced with L-lysine (in Homo sapiens)
L-glutamine 546 replaced with L-lysine (in Homo sapiens)
L-glutamine 546 replaced with L-lysine (in Homo sapiens)
L-glutamine 546 replaced with L-lysine (in Homo sapiens)
L-glutamine 546 replaced with L-lysine (in Homo sapiens)
L-glutamine 546 replaced with L-lysine (in Homo sapiens)
L-glutamine 546 replaced with L-lysine (in Homo sapiens)
L-glutamine 546 replaced with L-lysine (in Homo sapiens)
L-glutamine 546 replaced with L-lysine (in Homo sapiens)
L-glutamine 546 replaced with L-lysine (in Homo sapiens)
L-glutamine 546 replaced with L-proline
L-glutamine 621 replaced with L-arginine
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 621 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 636 replaced with L-arginine (in Homo sapiens)
L-glutamine 69 replaced with unknown
L-glutamine 70 replaced with unknown
L-glutamine 95 replaced with unknown
L-glutamine residue 94 replaced with unknown
L-glutamine residue 94 replaced with unknown (in Homo sapiens)
L-glutamine residue 94 replaced with unknown (in Homo sapiens)
L-glutamine residue 94 replaced with unknown (in Homo sapiens)
L-glutamine residue 94 replaced with unknown (in Homo sapiens)
L-glutamine residue 94 replaced with unknown (in Homo sapiens)
L-glutamine residue 94 replaced with unknown (in Homo sapiens)
L-glutamine residue 94 replaced with unknown (in Homo sapiens)
L-glutamine residue 94 replaced with unknown (in Homo sapiens)
L-glutamine residue 94 replaced with unknown (in Homo sapiens)
L-glutamine residue 94 replaced with unknown (in Homo sapiens)
L-glutamine residue 94 replaced with unknown (in Homo sapiens)
L-glutamine residue 94 replaced with unknown (in Homo sapiens)
L-glutamine residue 94 replaced with unknown (in Homo sapiens)
L-glutamine residue 94 replaced with unknown (in Homo sapiens)
L-glutamine residue 94 replaced with unknown (in Homo sapiens)
L-glutamine residue 94 replaced with unknown (in Homo sapiens)
L-glutamine residue 94 replaced with unknown (in Homo sapiens)
L-histidine 1047 replaced with L-arginine
L-histidine 1047 replaced with L-leucine
L-histidine 1047 replaced with L-leucine (in Homo sapiens)
L-histidine 1047 replaced with L-leucine (in Homo sapiens)
L-histidine 1047 replaced with L-leucine (in Homo sapiens)
L-histidine 1047 replaced with L-leucine (in Homo sapiens)
L-histidine 1047 replaced with L-leucine (in Homo sapiens)
L-histidine 1047 replaced with L-leucine (in Homo sapiens)
L-histidine 1047 replaced with L-leucine (in Homo sapiens)
L-histidine 1047 replaced with L-leucine (in Homo sapiens)
L-histidine 1047 replaced with L-leucine (in Homo sapiens)
L-histidine 1047 replaced with L-leucine (in Homo sapiens)
L-histidine 1047 replaced with L-leucine (in Homo sapiens)
L-histidine 1047 replaced with L-leucine (in Homo sapiens)
L-histidine 1047 replaced with L-leucine (in Homo sapiens)
L-histidine 1047 replaced with L-tyrosine
L-histidine 123 replaced with L-tyrosine
L-histidine 123 replaced with L-tyrosine (in Homo sapiens)
L-histidine 123 replaced with L-tyrosine (in Homo sapiens)
L-histidine 123 replaced with L-tyrosine (in Homo sapiens)
L-histidine 123 replaced with L-tyrosine (in Homo sapiens)
L-histidine 123 replaced with L-tyrosine (in Homo sapiens)
L-histidine 123 replaced with L-tyrosine (in Homo sapiens)
L-histidine 123 replaced with L-tyrosine (in Homo sapiens)
L-histidine 123 replaced with L-tyrosine (in Homo sapiens)
L-histidine 123 replaced with L-tyrosine (in Homo sapiens)
L-histidine 123 replaced with L-tyrosine (in Homo sapiens)
L-histidine 123 replaced with L-tyrosine (in Homo sapiens)
L-histidine 123 replaced with L-tyrosine (in Homo sapiens)
L-histidine 123 replaced with L-tyrosine (in Homo sapiens)
L-histidine 123 replaced with L-tyrosine (in Homo sapiens)
L-histidine 123 replaced with L-tyrosine (in Homo sapiens)
L-histidine 123 replaced with L-tyrosine (in Homo sapiens)
L-histidine 123 replaced with L-tyrosine (in Homo sapiens)
L-histidine 123 replaced with L-tyrosine (in Homo sapiens)
L-histidine 123 replaced with L-tyrosine (in Homo sapiens)
L-histidine 123 replaced with L-tyrosine (in Homo sapiens)
L-histidine 123 replaced with L-tyrosine (in Homo sapiens)
L-histidine 123 replaced with L-tyrosine (in Homo sapiens)
L-histidine 123 replaced with L-tyrosine (in Homo sapiens)
L-histidine 123 replaced with L-tyrosine (in Homo sapiens)
L-histidine 123 replaced with L-tyrosine (in Homo sapiens)
L-histidine 123 replaced with L-tyrosine (in Homo sapiens)
L-histidine 123 replaced with L-tyrosine (in Homo sapiens)
L-histidine 151 replaced with L-asparagine
L-histidine 262 replaced with L-arginine
L-histidine 264 replaced with L-isoleucine
L-histidine 331 replaced with L-isoleucine
L-histidine 331 replaced with L-isoleucine (in Homo sapiens)
L-histidine 331 replaced with L-isoleucine (in Homo sapiens)
L-histidine 331 replaced with L-isoleucine (in Homo sapiens)
L-histidine 331 replaced with L-isoleucine (in Homo sapiens)
L-histidine 331 replaced with L-isoleucine (in Homo sapiens)
L-histidine 331 replaced with L-isoleucine (in Homo sapiens)
L-histidine 331 replaced with L-isoleucine (in Homo sapiens)
L-histidine 331 replaced with L-isoleucine (in Homo sapiens)
L-histidine 331 replaced with L-isoleucine (in Homo sapiens)
L-histidine 331 replaced with L-isoleucine (in Homo sapiens)
L-histidine 331 replaced with L-isoleucine (in Homo sapiens)
L-histidine 331 replaced with L-isoleucine (in Homo sapiens)
L-histidine 331 replaced with L-isoleucine (in Homo sapiens)
L-histidine 331 replaced with L-isoleucine (in Homo sapiens)
L-histidine 331 replaced with L-isoleucine (in Homo sapiens)
L-histidine 331 replaced with L-isoleucine (in Homo sapiens)
L-histidine 331 replaced with L-isoleucine (in Homo sapiens)
L-histidine 370 replaced with L-leucine
L-histidine 374 replaced with L-arginine
L-histidine 393 replaced with L-proline
L-histidine 435 replaced with L-tyrosine
L-histidine 436 replaced with L-aspartic acid
L-histidine 773 replaced with glycine
L-histidine 920 replaced with L-aspartic acid
L-histidine 93 replaced with L-alanine
L-histidine 93 replaced with L-arginine
L-histidine 93 replaced with L-aspartic acid
L-histidine 93 replaced with L-glutamine
L-histidine 93 replaced with L-tyrosine
L-histidine 93 replaced with L-tyrosine (in Homo sapiens)
L-histidine 93 replaced with L-tyrosine (in Homo sapiens)
L-histidine 93 replaced with L-tyrosine (in Homo sapiens)
L-histidine 93 replaced with L-tyrosine (in Homo sapiens)
L-histidine 93 replaced with L-tyrosine (in Homo sapiens)
L-histidine 93 replaced with L-tyrosine (in Homo sapiens)
L-histidine 93 replaced with L-tyrosine (in Homo sapiens)
L-histidine 93 replaced with L-tyrosine (in Homo sapiens)
L-histidine 93 replaced with L-tyrosine (in Homo sapiens)
L-histidine 93 replaced with L-tyrosine (in Homo sapiens)
L-histidine 93 replaced with L-tyrosine (in Homo sapiens)
L-histidine 93 replaced with L-tyrosine (in Homo sapiens)
L-histidine 93 replaced with L-tyrosine (in Homo sapiens)
L-histidine 93 replaced with L-tyrosine (in Homo sapiens)
L-histidine 93 replaced with L-tyrosine (in Homo sapiens)
L-histidine 93 replaced with L-tyrosine (in Homo sapiens)
L-histidine 93 replaced with L-tyrosine (in Homo sapiens)
L-histidine 93 replaced with L-tyrosine (in Homo sapiens)
L-histidine 93 replaced with L-tyrosine (in Homo sapiens)
L-histidine 93 replaced with L-tyrosine (in Homo sapiens)
L-histidine 93 replaced with L-tyrosine (in Homo sapiens)
L-histidine 93 replaced with L-tyrosine (in Homo sapiens)
L-histidine 93 replaced with L-tyrosine (in Homo sapiens)
L-histidine 93 replaced with L-tyrosine (in Homo sapiens)
L-histidine 93 replaced with L-tyrosine (in Homo sapiens)
L-histidine 93 replaced with L-tyrosine (in Homo sapiens)
L-histidine 93 replaced with L-tyrosine (in Homo sapiens)
L-isoleucine 113 replaced with L-phenylalanine
L-isoleucine 147 replaced with L-serine
L-isoleucine 147 replaced with L-serine (in Homo sapiens)
L-isoleucine 147 replaced with L-serine (in Homo sapiens)
L-isoleucine 147 replaced with L-serine (in Homo sapiens)
L-isoleucine 147 replaced with L-serine (in Homo sapiens)
L-isoleucine 147 replaced with L-serine (in Homo sapiens)
L-isoleucine 147 replaced with L-serine (in Homo sapiens)
L-isoleucine 147 replaced with L-serine (in Homo sapiens)
L-isoleucine 147 replaced with L-serine (in Homo sapiens)
L-isoleucine 148 replaced with L-serine
L-isoleucine 148 replaced with L-serine (in Homo sapiens)
L-isoleucine 148 replaced with L-serine (in Homo sapiens)
L-isoleucine 148 replaced with L-serine (in Homo sapiens)
L-isoleucine 148 replaced with L-serine (in Homo sapiens)
L-isoleucine 148 replaced with L-serine (in Homo sapiens)
L-isoleucine 148 replaced with L-serine (in Homo sapiens)
L-isoleucine 148 replaced with L-serine (in Homo sapiens)
L-isoleucine 148 replaced with L-serine (in Homo sapiens)
L-isoleucine 1616 replaced with L-asparagine
L-isoleucine 1616 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 1616 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 1616 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 1616 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 1616 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 1616 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 1616 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 1616 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 1616 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 1616 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 1616 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 1616 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 1616 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 1616 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 1616 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 1616 replaced with L-threonine
L-isoleucine 1680 replaced with L-asparagine
L-isoleucine 1680 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 1680 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 1680 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 1680 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 1680 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 1680 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 1680 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 1680 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 1680 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 1680 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 1680 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 1680 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 1680 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 1680 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 1680 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 1718 replaced with L-threonine
L-isoleucine 1718 replaced with L-threonine (in Homo sapiens)
L-isoleucine 1718 replaced with L-threonine (in Homo sapiens)
L-isoleucine 1718 replaced with L-threonine (in Homo sapiens)
L-isoleucine 1718 replaced with L-threonine (in Homo sapiens)
L-isoleucine 1718 replaced with L-threonine (in Homo sapiens)
L-isoleucine 1718 replaced with L-threonine (in Homo sapiens)
L-isoleucine 1718 replaced with L-threonine (in Homo sapiens)
L-isoleucine 1718 replaced with L-threonine (in Homo sapiens)
L-isoleucine 1718 replaced with L-threonine (in Homo sapiens)
L-isoleucine 1718 replaced with L-threonine (in Homo sapiens)
L-isoleucine 1718 replaced with L-threonine (in Homo sapiens)
L-isoleucine 1718 replaced with L-threonine (in Homo sapiens)
L-isoleucine 1718 replaced with L-threonine (in Homo sapiens)
L-isoleucine 1718 replaced with L-threonine (in Homo sapiens)
L-isoleucine 1718 replaced with L-threonine (in Homo sapiens)
L-isoleucine 22 replaced with L-methionine
L-isoleucine 287 replaced with L-tyrosine
L-isoleucine 329 replaced with L-leucine
L-isoleucine 329 replaced with L-leucine (in Homo sapiens)
L-isoleucine 329 replaced with L-leucine (in Homo sapiens)
L-isoleucine 329 replaced with L-leucine (in Homo sapiens)
L-isoleucine 329 replaced with L-leucine (in Homo sapiens)
L-isoleucine 329 replaced with L-leucine (in Homo sapiens)
L-isoleucine 329 replaced with L-leucine (in Homo sapiens)
L-isoleucine 329 replaced with L-leucine (in Homo sapiens)
L-isoleucine 329 replaced with L-leucine (in Homo sapiens)
L-isoleucine 329 replaced with L-leucine (in Homo sapiens)
L-isoleucine 329 replaced with L-leucine (in Homo sapiens)
L-isoleucine 329 replaced with L-leucine (in Homo sapiens)
L-isoleucine 329 replaced with L-leucine (in Homo sapiens)
L-isoleucine 329 replaced with L-leucine (in Homo sapiens)
L-isoleucine 329 replaced with L-leucine (in Homo sapiens)
L-isoleucine 329 replaced with L-leucine (in Homo sapiens)
L-isoleucine 329 replaced with L-leucine (in Homo sapiens)
L-isoleucine 329 replaced with L-leucine (in Homo sapiens)
L-isoleucine 41 replaced with L-asparagine
L-isoleucine 41 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 41 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 41 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 41 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 41 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 41 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 41 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 41 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 41 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 41 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 41 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 41 replaced with L-asparagine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 567 replaced with L-valine (in Homo sapiens)
L-isoleucine 65 replaced with L-asparagine
L-isoleucine 881 replaced with unknown
L-leucine 119 replaced with L-proline
L-leucine 120 replaced with L-methionine
L-leucine 137 replaced with L-glutamine
L-leucine 15 replaced with L-arginine
L-leucine 1574 replaced with L-glutamine
L-leucine 1574 replaced with L-proline
L-leucine 1574 replaced with L-proline (in Homo sapiens)
L-leucine 1574 replaced with L-proline (in Homo sapiens)
L-leucine 1574 replaced with L-proline (in Homo sapiens)
L-leucine 1574 replaced with L-proline (in Homo sapiens)
L-leucine 1574 replaced with L-proline (in Homo sapiens)
L-leucine 1574 replaced with L-proline (in Homo sapiens)
L-leucine 1574 replaced with L-proline (in Homo sapiens)
L-leucine 1574 replaced with L-proline (in Homo sapiens)
L-leucine 1574 replaced with L-proline (in Homo sapiens)
L-leucine 1574 replaced with L-proline (in Homo sapiens)
L-leucine 1574 replaced with L-proline (in Homo sapiens)
L-leucine 1574 replaced with L-proline (in Homo sapiens)
L-leucine 1574 replaced with L-proline (in Homo sapiens)
L-leucine 1574 replaced with L-proline (in Homo sapiens)
L-leucine 1574 replaced with L-proline (in Homo sapiens)
L-leucine 158 replaced with L-proline
L-leucine 1593 replaced with L-proline
L-leucine 1593 replaced with L-proline (in Homo sapiens)
L-leucine 1593 replaced with L-proline (in Homo sapiens)
L-leucine 1593 replaced with L-proline (in Homo sapiens)
L-leucine 1593 replaced with L-proline (in Homo sapiens)
L-leucine 1593 replaced with L-proline (in Homo sapiens)
L-leucine 1593 replaced with L-proline (in Homo sapiens)
L-leucine 1593 replaced with L-proline (in Homo sapiens)
L-leucine 1593 replaced with L-proline (in Homo sapiens)
L-leucine 1593 replaced with L-proline (in Homo sapiens)
L-leucine 1593 replaced with L-proline (in Homo sapiens)
L-leucine 1593 replaced with L-proline (in Homo sapiens)
L-leucine 1593 replaced with L-proline (in Homo sapiens)
L-leucine 1593 replaced with L-proline (in Homo sapiens)
L-leucine 1593 replaced with L-proline (in Homo sapiens)
L-leucine 1593 replaced with L-proline (in Homo sapiens)
L-leucine 1596 replaced with L-histidine
L-leucine 1596 replaced with L-histidine (in Homo sapiens)
L-leucine 1596 replaced with L-histidine (in Homo sapiens)
L-leucine 1596 replaced with L-histidine (in Homo sapiens)
L-leucine 1596 replaced with L-histidine (in Homo sapiens)
L-leucine 1596 replaced with L-histidine (in Homo sapiens)
L-leucine 1596 replaced with L-histidine (in Homo sapiens)
L-leucine 1596 replaced with L-histidine (in Homo sapiens)
L-leucine 1596 replaced with L-histidine (in Homo sapiens)
L-leucine 1596 replaced with L-histidine (in Homo sapiens)
L-leucine 1596 replaced with L-histidine (in Homo sapiens)
L-leucine 1596 replaced with L-histidine (in Homo sapiens)
L-leucine 1596 replaced with L-histidine (in Homo sapiens)
L-leucine 1596 replaced with L-histidine (in Homo sapiens)
L-leucine 1596 replaced with L-histidine (in Homo sapiens)
L-leucine 1596 replaced with L-histidine (in Homo sapiens)
L-leucine 160 replaced with L-cysteine
L-leucine 160 replaced with L-cysteine (in Homo sapiens)
L-leucine 160 replaced with L-cysteine (in Homo sapiens)
L-leucine 160 replaced with L-cysteine (in Homo sapiens)
L-leucine 160 replaced with L-cysteine (in Homo sapiens)
L-leucine 160 replaced with L-cysteine (in Homo sapiens)
L-leucine 160 replaced with L-cysteine (in Homo sapiens)
L-leucine 160 replaced with L-cysteine (in Homo sapiens)
L-leucine 160 replaced with L-cysteine (in Homo sapiens)
L-leucine 1600 replaced with L-proline
L-leucine 1600 replaced with L-proline (in Homo sapiens)
L-leucine 1600 replaced with L-proline (in Homo sapiens)
L-leucine 1600 replaced with L-proline (in Homo sapiens)
L-leucine 1600 replaced with L-proline (in Homo sapiens)
L-leucine 1600 replaced with L-proline (in Homo sapiens)
L-leucine 1600 replaced with L-proline (in Homo sapiens)
L-leucine 1600 replaced with L-proline (in Homo sapiens)
L-leucine 1600 replaced with L-proline (in Homo sapiens)
L-leucine 1600 replaced with L-proline (in Homo sapiens)
L-leucine 1600 replaced with L-proline (in Homo sapiens)
L-leucine 1600 replaced with L-proline (in Homo sapiens)
L-leucine 1600 replaced with L-proline (in Homo sapiens)
L-leucine 1600 replaced with L-proline (in Homo sapiens)
L-leucine 1600 replaced with L-proline (in Homo sapiens)
L-leucine 1600 replaced with L-proline (in Homo sapiens)
L-leucine 161 replaced with L-cysteine
L-leucine 161 replaced with L-cysteine (in Homo sapiens)
L-leucine 161 replaced with L-cysteine (in Homo sapiens)
L-leucine 161 replaced with L-cysteine (in Homo sapiens)
L-leucine 161 replaced with L-cysteine (in Homo sapiens)
L-leucine 161 replaced with L-cysteine (in Homo sapiens)
L-leucine 161 replaced with L-cysteine (in Homo sapiens)
L-leucine 161 replaced with L-cysteine (in Homo sapiens)
L-leucine 161 replaced with L-cysteine (in Homo sapiens)
L-leucine 1678 replaced with L-proline
L-leucine 1678 replaced with L-proline (in Homo sapiens)
L-leucine 1678 replaced with L-proline (in Homo sapiens)
L-leucine 1678 replaced with L-proline (in Homo sapiens)
L-leucine 1678 replaced with L-proline (in Homo sapiens)
L-leucine 1678 replaced with L-proline (in Homo sapiens)
L-leucine 1678 replaced with L-proline (in Homo sapiens)
L-leucine 1678 replaced with L-proline (in Homo sapiens)
L-leucine 1678 replaced with L-proline (in Homo sapiens)
L-leucine 1678 replaced with L-proline (in Homo sapiens)
L-leucine 1678 replaced with L-proline (in Homo sapiens)
L-leucine 1678 replaced with L-proline (in Homo sapiens)
L-leucine 1678 replaced with L-proline (in Homo sapiens)
L-leucine 1678 replaced with L-proline (in Homo sapiens)
L-leucine 1678 replaced with L-proline (in Homo sapiens)
L-leucine 1678 replaced with L-proline (in Homo sapiens)
L-leucine 200 replaced with L-arginine
L-leucine 206 replaced with L-proline
L-leucine 216 replaced with L-arginine
L-leucine 237 replaced with L-proline
L-leucine 259 replaced with L-proline
L-leucine 259 replaced with L-proline
L-leucine 259 replaced with L-proline (in Homo sapiens)
L-leucine 259 replaced with L-proline (in Homo sapiens)
L-leucine 259 replaced with L-proline (in Homo sapiens)
L-leucine 259 replaced with L-proline (in Homo sapiens)
L-leucine 259 replaced with L-proline (in Homo sapiens)
L-leucine 259 replaced with L-proline (in Homo sapiens)
L-leucine 259 replaced with L-proline (in Homo sapiens)
L-leucine 259 replaced with L-proline (in Homo sapiens)
L-leucine 259 replaced with L-proline (in Homo sapiens)
L-leucine 259 replaced with L-proline (in Homo sapiens)
L-leucine 259 replaced with L-proline (in Homo sapiens)
L-leucine 259 replaced with L-proline (in Homo sapiens)
L-leucine 259 replaced with L-proline (in Homo sapiens)
L-leucine 259 replaced with L-proline (in Homo sapiens)
L-leucine 259 replaced with L-proline (in Homo sapiens)
L-leucine 259 replaced with L-proline (in Homo sapiens)
L-leucine 259 replaced with L-proline (in Homo sapiens)
L-leucine 259 replaced with L-proline (in Homo sapiens)
L-leucine 276 replaced with L-proline
L-leucine 286 replaced with L-proline
L-leucine 307 replaced with L-proline
L-leucine 343 replaced with L-phenylalanine
L-leucine 354 replaced with L-asparagine
L-leucine 354 replaced with L-asparagine (in Homo sapiens)
L-leucine 354 replaced with L-asparagine (in Homo sapiens)
L-leucine 354 replaced with L-asparagine (in Homo sapiens)
L-leucine 354 replaced with L-asparagine (in Homo sapiens)
L-leucine 354 replaced with L-asparagine (in Homo sapiens)
L-leucine 354 replaced with L-asparagine (in Homo sapiens)
L-leucine 354 replaced with L-asparagine (in Homo sapiens)
L-leucine 354 replaced with L-asparagine (in Homo sapiens)
L-leucine 354 replaced with L-asparagine (in Homo sapiens)
L-leucine 354 replaced with L-asparagine (in Homo sapiens)
L-leucine 354 replaced with L-asparagine (in Homo sapiens)
L-leucine 354 replaced with L-asparagine (in Homo sapiens)
L-leucine 354 replaced with L-asparagine (in Homo sapiens)
L-leucine 354 replaced with L-asparagine (in Homo sapiens)
L-leucine 354 replaced with L-asparagine (in Homo sapiens)
L-leucine 354 replaced with L-asparagine (in Homo sapiens)
L-leucine 354 replaced with L-asparagine (in Homo sapiens)
L-leucine 381 replaced with L-serine
L-leucine 382 replaced with L-proline
L-leucine 396 replaced with L-methionine
L-leucine 396 replaced with L-methionine (in Homo sapiens)
L-leucine 396 replaced with L-methionine (in Homo sapiens)
L-leucine 396 replaced with L-methionine (in Homo sapiens)
L-leucine 396 replaced with L-methionine (in Homo sapiens)
L-leucine 396 replaced with L-methionine (in Homo sapiens)
L-leucine 396 replaced with L-methionine (in Homo sapiens)
L-leucine 396 replaced with L-methionine (in Homo sapiens)
L-leucine 396 replaced with L-methionine (in Homo sapiens)
L-leucine 396 replaced with L-methionine (in Homo sapiens)
L-leucine 396 replaced with L-methionine (in Homo sapiens)
L-leucine 396 replaced with L-methionine (in Homo sapiens)
L-leucine 396 replaced with L-methionine (in Homo sapiens)
L-leucine 396 replaced with L-methionine (in Homo sapiens)
L-leucine 461 replaced with L-proline
L-leucine 483 replaced with L-proline
L-leucine 488 replaced with L-proline
L-leucine 74 replaced with L-serine
L-leucine 83 replaced with L-proline
L-leucine 858 replaced with L-arginine
L-leucine 858 replaced with L-arginine (in Homo sapiens)
L-leucine 858 replaced with L-arginine (in Homo sapiens)
L-leucine 858 replaced with L-arginine (in Homo sapiens)
L-leucine 858 replaced with L-arginine (in Homo sapiens)
L-leucine 858 replaced with L-arginine (in Homo sapiens)
L-leucine 858 replaced with L-arginine (in Homo sapiens)
L-leucine 858 replaced with L-arginine (in Homo sapiens)
L-leucine 858 replaced with L-arginine (in Homo sapiens)
L-leucine 858 replaced with L-arginine (in Homo sapiens)
L-leucine 858 replaced with L-arginine (in Homo sapiens)
L-leucine 858 replaced with L-arginine (in Homo sapiens)
L-leucine 858 replaced with L-arginine (in Homo sapiens)
L-leucine 858 replaced with L-arginine (in Homo sapiens)
L-leucine 858 replaced with L-arginine (in Homo sapiens)
L-leucine 858 replaced with L-arginine (in Homo sapiens)
L-leucine 858 replaced with L-arginine (in Homo sapiens)
L-leucine 86 replaced with L-serine
L-leucine 861 replaced with L-glutamine
L-leucine 99 replaced with L-proline
L-leucine residue 573 replaced with unknown
L-leucine residue 573 replaced with unknown (in Homo sapiens)
L-leucine residue 573 replaced with unknown (in Homo sapiens)
L-leucine residue 573 replaced with unknown (in Homo sapiens)
L-leucine residue 573 replaced with unknown (in Homo sapiens)
L-leucine residue 573 replaced with unknown (in Homo sapiens)
L-leucine residue 573 replaced with unknown (in Homo sapiens)
L-leucine residue 573 replaced with unknown (in Homo sapiens)
L-leucine residue 573 replaced with unknown (in Homo sapiens)
L-leucine residue 573 replaced with unknown (in Homo sapiens)
L-leucine residue 573 replaced with unknown (in Homo sapiens)
L-leucine residue 573 replaced with unknown (in Homo sapiens)
L-leucine residue 573 replaced with unknown (in Homo sapiens)
L-leucine residue 573 replaced with unknown (in Homo sapiens)
L-leucine residue 573 replaced with unknown (in Homo sapiens)
L-leucine residue 573 replaced with unknown (in Homo sapiens)
L-leucine residue 573 replaced with unknown (in Homo sapiens)
L-leucine residue 573 replaced with unknown (in Homo sapiens)
L-leucine residue 573 replaced with unknown (in Homo sapiens)
L-leucine residue 573 replaced with unknown (in Homo sapiens)
L-leucine residue 573 replaced with unknown (in Homo sapiens)
L-lysine 128 replaced with L-alanine
L-lysine 128 replaced with L-alanine (in Homo sapiens)
L-lysine 128 replaced with L-alanine (in Homo sapiens)
L-lysine 128 replaced with L-alanine (in Homo sapiens)
L-lysine 128 replaced with L-alanine (in Homo sapiens)
L-lysine 128 replaced with L-alanine (in Homo sapiens)
L-lysine 128 replaced with L-alanine (in Homo sapiens)
L-lysine 128 replaced with L-alanine (in Homo sapiens)
L-lysine 128 replaced with L-alanine (in Homo sapiens)
L-lysine 128 replaced with L-serine
L-lysine 174 replaced with L-arginine
L-lysine 237 replaced with L-asparagine
L-lysine 25 replaced with unknown
L-lysine 25 replaced with unknown (in Homo sapiens)
L-lysine 25 replaced with unknown (in Homo sapiens)
L-lysine 25 replaced with unknown (in Homo sapiens)
L-lysine 25 replaced with unknown (in Homo sapiens)
L-lysine 25 replaced with unknown (in Homo sapiens)
L-lysine 25 replaced with unknown (in Homo sapiens)
L-lysine 25 replaced with unknown (in Homo sapiens)
L-lysine 25 replaced with unknown (in Homo sapiens)
L-lysine 25 replaced with unknown (in Homo sapiens)
L-lysine 25 replaced with unknown (in Homo sapiens)
L-lysine 25 replaced with unknown (in Homo sapiens)
L-lysine 25 replaced with unknown (in Homo sapiens)
L-lysine 25 replaced with unknown (in Homo sapiens)
L-lysine 53 replaced with L-glutamic acid
L-lysine 53 replaced with L-proline
L-lysine 53 replaced with L-proline (in Homo sapiens)
L-lysine 53 replaced with L-proline (in Homo sapiens)
L-lysine 53 replaced with L-proline (in Homo sapiens)
L-lysine 53 replaced with L-proline (in Homo sapiens)
L-lysine 53 replaced with L-proline (in Homo sapiens)
L-lysine 53 replaced with L-proline (in Homo sapiens)
L-lysine 53 replaced with L-proline (in Homo sapiens)
L-lysine 53 replaced with L-proline (in Homo sapiens)
L-lysine 53 replaced with L-proline (in Homo sapiens)
L-lysine 53 replaced with L-proline (in Homo sapiens)
L-lysine 53 replaced with L-proline (in Homo sapiens)
L-lysine 53 replaced with L-proline (in Homo sapiens)
L-lysine 650 replaced with L-asparagine
L-lysine 650 replaced with L-glutamic acid
L-lysine 650 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 650 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 650 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 650 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 650 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 650 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 650 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 650 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 650 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 650 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 650 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 650 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 650 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 650 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 650 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 650 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 650 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 650 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 650 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 650 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 650 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 650 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 650 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 650 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 650 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 650 replaced with L-glutamine
L-lysine 650 replaced with L-methionine
L-lysine 650 replaced with L-threonine
L-lysine 656 replaced with L-glutamic acid
L-lysine 656 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 656 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 656 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 656 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 656 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 656 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 656 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 656 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 656 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 656 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 656 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 656 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 656 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 656 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 656 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 656 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 656 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 656 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 656 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 656 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 656 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 656 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 656 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 656 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 656 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 656 replaced with L-glutamic acid (in Homo sapiens)
L-lysine 660 replaced with L-asparagine
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-asparagine (in Homo sapiens)
L-lysine 660 replaced with L-glutamic acid
L-lysine 660 replaced with L-methionine
L-lysine 69 replaced with unknown
L-lysine residue 428 replaced with L-arginine
L-lysine residue 428 replaced with L-threonine
L-lysine residue 428 replaced with L-threonine (in Homo sapiens)
L-lysine residue 428 replaced with L-threonine (in Homo sapiens)
L-lysine residue 428 replaced with L-threonine (in Homo sapiens)
L-lysine residue 428 replaced with L-threonine (in Homo sapiens)
L-lysine residue 428 replaced with L-threonine (in Homo sapiens)
L-lysine residue 428 replaced with L-threonine (in Homo sapiens)
L-lysine residue 428 replaced with L-threonine (in Homo sapiens)
L-lysine residue 428 replaced with L-threonine (in Homo sapiens)
L-lysine residue 428 replaced with L-threonine (in Homo sapiens)
L-lysine residue 428 replaced with L-threonine (in Homo sapiens)
L-lysine residue 428 replaced with L-threonine (in Homo sapiens)
L-lysine residue 428 replaced with L-threonine (in Homo sapiens)
L-lysine residue 428 replaced with L-threonine (in Homo sapiens)
L-lysine residue 428 replaced with L-threonine (in Homo sapiens)
L-lysine residue 428 replaced with L-threonine (in Homo sapiens)
L-lysine residue 428 replaced with L-threonine (in Homo sapiens)
L-lysine residue 428 replaced with L-threonine (in Homo sapiens)
L-lysine residue 428 replaced with L-threonine (in Homo sapiens)
L-lysine residue 428 replaced with L-threonine (in Homo sapiens)
L-methionine 1 replaced with L-threonine
L-methionine 1 replaced with L-threonine
L-methionine 1043 replaced with L-isoleucine
L-methionine 1043 replaced with L-isoleucine (in Homo sapiens)
L-methionine 1043 replaced with L-isoleucine (in Homo sapiens)
L-methionine 1043 replaced with L-isoleucine (in Homo sapiens)
L-methionine 1043 replaced with L-isoleucine (in Homo sapiens)
L-methionine 1043 replaced with L-isoleucine (in Homo sapiens)
L-methionine 1043 replaced with L-isoleucine (in Homo sapiens)
L-methionine 1043 replaced with L-isoleucine (in Homo sapiens)
L-methionine 1043 replaced with L-isoleucine (in Homo sapiens)
L-methionine 1043 replaced with L-isoleucine (in Homo sapiens)
L-methionine 1043 replaced with L-isoleucine (in Homo sapiens)
L-methionine 1043 replaced with L-isoleucine (in Homo sapiens)
L-methionine 1043 replaced with L-isoleucine (in Homo sapiens)
L-methionine 1043 replaced with L-isoleucine (in Homo sapiens)
L-methionine 1043 replaced with L-threonine
L-methionine 1043 replaced with L-valine
L-methionine 108 replaced with L-isoleucine
L-methionine 135 replaced with L-cysteine
L-methionine 135 replaced with L-cysteine (in Homo sapiens)
L-methionine 135 replaced with L-cysteine (in Homo sapiens)
L-methionine 135 replaced with L-cysteine (in Homo sapiens)
L-methionine 135 replaced with L-cysteine (in Homo sapiens)
L-methionine 135 replaced with L-cysteine (in Homo sapiens)
L-methionine 135 replaced with L-cysteine (in Homo sapiens)
L-methionine 135 replaced with L-cysteine (in Homo sapiens)
L-methionine 135 replaced with L-cysteine (in Homo sapiens)
L-methionine 157 replaced with L-lysine
L-methionine 377 replaced with L-valine
L-methionine 66 replaced with L-isoleucine
L-methionine residue 1 replaced with unknown
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-methionine residue 1 replaced with unknown (in Homo sapiens)
L-phenylalanine 1197 replaced with unknown
L-phenylalanine 1197 replaced with unknown (in Homo sapiens)
L-phenylalanine 1197 replaced with unknown (in Homo sapiens)
L-phenylalanine 1197 replaced with unknown (in Homo sapiens)
L-phenylalanine 1197 replaced with unknown (in Homo sapiens)
L-phenylalanine 1197 replaced with unknown (in Homo sapiens)
L-phenylalanine 1197 replaced with unknown (in Homo sapiens)
L-phenylalanine 1197 replaced with unknown (in Homo sapiens)
L-phenylalanine 1197 replaced with unknown (in Homo sapiens)
L-phenylalanine 1197 replaced with unknown (in Homo sapiens)
L-phenylalanine 1197 replaced with unknown (in Homo sapiens)
L-phenylalanine 1197 replaced with unknown (in Homo sapiens)
L-phenylalanine 1197 replaced with unknown (in Homo sapiens)
L-phenylalanine 1197 replaced with unknown (in Homo sapiens)
L-phenylalanine 1197 replaced with unknown (in Homo sapiens)
L-phenylalanine 1197 replaced with unknown (in Homo sapiens)
L-phenylalanine 1197 replaced with unknown (in Homo sapiens)
L-phenylalanine 1197 replaced with unknown (in Homo sapiens)
L-phenylalanine 1197 replaced with unknown (in Homo sapiens)
L-phenylalanine 1197 replaced with unknown (in Homo sapiens)
L-phenylalanine 1197 replaced with unknown (in Homo sapiens)
L-phenylalanine 1197 replaced with unknown (in Homo sapiens)
L-phenylalanine 1197 replaced with unknown (in Homo sapiens)
L-phenylalanine 1197 replaced with unknown (in Homo sapiens)
L-phenylalanine 133 replaced with L-serine
L-phenylalanine 133 replaced with L-serine (in Homo sapiens)
L-phenylalanine 133 replaced with L-serine (in Homo sapiens)
L-phenylalanine 133 replaced with L-serine (in Homo sapiens)
L-phenylalanine 133 replaced with L-serine (in Homo sapiens)
L-phenylalanine 133 replaced with L-serine (in Homo sapiens)
L-phenylalanine 133 replaced with L-serine (in Homo sapiens)
L-phenylalanine 133 replaced with L-serine (in Homo sapiens)
L-phenylalanine 133 replaced with L-serine (in Homo sapiens)
L-phenylalanine 134 replaced with L-serine
L-phenylalanine 134 replaced with L-serine (in Homo sapiens)
L-phenylalanine 134 replaced with L-serine (in Homo sapiens)
L-phenylalanine 134 replaced with L-serine (in Homo sapiens)
L-phenylalanine 134 replaced with L-serine (in Homo sapiens)
L-phenylalanine 134 replaced with L-serine (in Homo sapiens)
L-phenylalanine 134 replaced with L-serine (in Homo sapiens)
L-phenylalanine 134 replaced with L-serine (in Homo sapiens)
L-phenylalanine 134 replaced with L-serine (in Homo sapiens)
L-phenylalanine 142 replaced with L-valine
L-phenylalanine 149 replaced with L-serine
L-phenylalanine 149 replaced with L-serine (in Homo sapiens)
L-phenylalanine 149 replaced with L-serine (in Homo sapiens)
L-phenylalanine 149 replaced with L-serine (in Homo sapiens)
L-phenylalanine 149 replaced with L-serine (in Homo sapiens)
L-phenylalanine 149 replaced with L-serine (in Homo sapiens)
L-phenylalanine 149 replaced with L-serine (in Homo sapiens)
L-phenylalanine 149 replaced with L-serine (in Homo sapiens)
L-phenylalanine 149 replaced with L-serine (in Homo sapiens)
L-phenylalanine 1592 replaced with L-serine
L-phenylalanine 1592 replaced with L-serine (in Homo sapiens)
L-phenylalanine 1592 replaced with L-serine (in Homo sapiens)
L-phenylalanine 1592 replaced with L-serine (in Homo sapiens)
L-phenylalanine 1592 replaced with L-serine (in Homo sapiens)
L-phenylalanine 1592 replaced with L-serine (in Homo sapiens)
L-phenylalanine 1592 replaced with L-serine (in Homo sapiens)
L-phenylalanine 1592 replaced with L-serine (in Homo sapiens)
L-phenylalanine 1592 replaced with L-serine (in Homo sapiens)
L-phenylalanine 1592 replaced with L-serine (in Homo sapiens)
L-phenylalanine 1592 replaced with L-serine (in Homo sapiens)
L-phenylalanine 1592 replaced with L-serine (in Homo sapiens)
L-phenylalanine 1592 replaced with L-serine (in Homo sapiens)
L-phenylalanine 1592 replaced with L-serine (in Homo sapiens)
L-phenylalanine 1592 replaced with L-serine (in Homo sapiens)
L-phenylalanine 1592 replaced with L-serine (in Homo sapiens)
L-phenylalanine 216 replaced with L-serine
L-phenylalanine 270 replaced with L-isoleucine
L-phenylalanine 33 replaced with L-serine
L-phenylalanine 470 replaced with L-isoleucine
L-phenylalanine 652 replaced with L-leucine
L-phenylalanine 69 replaced with L-cysteine
L-phenylalanine 84 replaced with L-leucine
L-proline 116 replaced with L-histidine
L-proline 1173 replaced with L-leucine
L-proline 129 replaced with L-leucine
L-proline 129 replaced with L-tryptophan
L-proline 129 replaced with L-tryptophan (in Homo sapiens)
L-proline 129 replaced with L-tryptophan (in Homo sapiens)
L-proline 129 replaced with L-tryptophan (in Homo sapiens)
L-proline 129 replaced with L-tryptophan (in Homo sapiens)
L-proline 129 replaced with L-tryptophan (in Homo sapiens)
L-proline 129 replaced with L-tryptophan (in Homo sapiens)
L-proline 129 replaced with L-tryptophan (in Homo sapiens)
L-proline 129 replaced with L-tryptophan (in Homo sapiens)
L-proline 1297 replaced with L-leucine
L-proline 153 replaced with L-leucine
L-proline 158 replaced with L-leucine
L-proline 158 replaced with L-leucine
L-proline 158 replaced with L-leucine (in Homo sapiens)
L-proline 158 replaced with L-leucine (in Homo sapiens)
L-proline 158 replaced with L-leucine (in Homo sapiens)
L-proline 158 replaced with L-leucine (in Homo sapiens)
L-proline 158 replaced with L-leucine (in Homo sapiens)
L-proline 158 replaced with L-leucine (in Homo sapiens)
L-proline 158 replaced with L-leucine (in Homo sapiens)
L-proline 158 replaced with L-leucine (in Homo sapiens)
L-proline 2474 replaced with L-alanine
L-proline 2474 replaced with L-alanine (in Homo sapiens)
L-proline 2474 replaced with L-alanine (in Homo sapiens)
L-proline 2474 replaced with L-alanine (in Homo sapiens)
L-proline 2474 replaced with L-alanine (in Homo sapiens)
L-proline 2474 replaced with L-alanine (in Homo sapiens)
L-proline 2474 replaced with L-alanine (in Homo sapiens)
L-proline 2474 replaced with L-alanine (in Homo sapiens)
L-proline 2474 replaced with L-alanine (in Homo sapiens)
L-proline 2474 replaced with L-alanine (in Homo sapiens)
L-proline 2474 replaced with L-alanine (in Homo sapiens)
L-proline 2474 replaced with L-alanine (in Homo sapiens)
L-proline 2474 replaced with L-alanine (in Homo sapiens)
L-proline 2474 replaced with L-alanine (in Homo sapiens)
L-proline 2474 replaced with L-alanine (in Homo sapiens)
L-proline 2474 replaced with L-alanine (in Homo sapiens)
L-proline 2475 replaced with L-histidine
L-proline 2475 replaced with L-histidine (in Homo sapiens)
L-proline 2475 replaced with L-histidine (in Homo sapiens)
L-proline 2475 replaced with L-histidine (in Homo sapiens)
L-proline 2475 replaced with L-histidine (in Homo sapiens)
L-proline 2475 replaced with L-histidine (in Homo sapiens)
L-proline 2475 replaced with L-histidine (in Homo sapiens)
L-proline 2475 replaced with L-histidine (in Homo sapiens)
L-proline 2475 replaced with L-histidine (in Homo sapiens)
L-proline 2475 replaced with L-histidine (in Homo sapiens)
L-proline 2475 replaced with L-histidine (in Homo sapiens)
L-proline 2475 replaced with L-histidine (in Homo sapiens)
L-proline 2475 replaced with L-histidine (in Homo sapiens)
L-proline 2475 replaced with L-histidine (in Homo sapiens)
L-proline 2475 replaced with L-histidine (in Homo sapiens)
L-proline 2475 replaced with L-histidine (in Homo sapiens)
L-proline 250 replaced with L-arginine
L-proline 250 replaced with L-arginine (in Homo sapiens)
L-proline 250 replaced with L-arginine (in Homo sapiens)
L-proline 250 replaced with L-arginine (in Homo sapiens)
L-proline 250 replaced with L-arginine (in Homo sapiens)
L-proline 250 replaced with L-arginine (in Homo sapiens)
L-proline 250 replaced with L-arginine (in Homo sapiens)
L-proline 250 replaced with L-arginine (in Homo sapiens)
L-proline 250 replaced with L-arginine (in Homo sapiens)
L-proline 250 replaced with L-arginine (in Homo sapiens)
L-proline 250 replaced with L-arginine (in Homo sapiens)
L-proline 250 replaced with L-arginine (in Homo sapiens)
L-proline 250 replaced with L-arginine (in Homo sapiens)
L-proline 250 replaced with L-arginine (in Homo sapiens)
L-proline 250 replaced with L-arginine (in Homo sapiens)
L-proline 250 replaced with L-arginine (in Homo sapiens)
L-proline 250 replaced with L-arginine (in Homo sapiens)
L-proline 250 replaced with L-arginine (in Homo sapiens)
L-proline 250 replaced with L-arginine (in Homo sapiens)
L-proline 250 replaced with L-arginine (in Homo sapiens)
L-proline 250 replaced with L-arginine (in Homo sapiens)
L-proline 250 replaced with L-arginine (in Homo sapiens)
L-proline 250 replaced with L-arginine (in Homo sapiens)
L-proline 250 replaced with L-arginine (in Homo sapiens)
L-proline 250 replaced with L-arginine (in Homo sapiens)
L-proline 250 replaced with L-arginine (in Homo sapiens)
L-proline 2514 replaced with L-arginine
L-proline 2514 replaced with L-arginine (in Homo sapiens)
L-proline 2514 replaced with L-arginine (in Homo sapiens)
L-proline 2514 replaced with L-arginine (in Homo sapiens)
L-proline 2514 replaced with L-arginine (in Homo sapiens)
L-proline 2514 replaced with L-arginine (in Homo sapiens)
L-proline 2514 replaced with L-arginine (in Homo sapiens)
L-proline 2514 replaced with L-arginine (in Homo sapiens)
L-proline 2514 replaced with L-arginine (in Homo sapiens)
L-proline 2514 replaced with L-arginine (in Homo sapiens)
L-proline 2514 replaced with L-arginine (in Homo sapiens)
L-proline 2514 replaced with L-arginine (in Homo sapiens)
L-proline 2514 replaced with L-arginine (in Homo sapiens)
L-proline 2514 replaced with L-arginine (in Homo sapiens)
L-proline 2514 replaced with L-arginine (in Homo sapiens)
L-proline 2514 replaced with L-arginine (in Homo sapiens)
L-proline 252 replaced with L-arginine
L-proline 252 replaced with L-serine
L-proline 252 replaced with L-serine (in Homo sapiens)
L-proline 252 replaced with L-serine (in Homo sapiens)
L-proline 252 replaced with L-serine (in Homo sapiens)
L-proline 252 replaced with L-serine (in Homo sapiens)
L-proline 252 replaced with L-serine (in Homo sapiens)
L-proline 252 replaced with L-serine (in Homo sapiens)
L-proline 252 replaced with L-serine (in Homo sapiens)
L-proline 252 replaced with L-serine (in Homo sapiens)
L-proline 252 replaced with L-serine (in Homo sapiens)
L-proline 252 replaced with L-serine (in Homo sapiens)
L-proline 252 replaced with L-serine (in Homo sapiens)
L-proline 252 replaced with L-serine (in Homo sapiens)
L-proline 252 replaced with L-serine (in Homo sapiens)
L-proline 252 replaced with L-serine (in Homo sapiens)
L-proline 252 replaced with L-serine (in Homo sapiens)
L-proline 252 replaced with L-serine (in Homo sapiens)
L-proline 252 replaced with L-serine (in Homo sapiens)
L-proline 252 replaced with L-serine (in Homo sapiens)
L-proline 252 replaced with L-serine (in Homo sapiens)
L-proline 252 replaced with L-serine (in Homo sapiens)
L-proline 252 replaced with L-serine (in Homo sapiens)
L-proline 252 replaced with L-serine (in Homo sapiens)
L-proline 252 replaced with L-serine (in Homo sapiens)
L-proline 252 replaced with L-serine (in Homo sapiens)
L-proline 252 replaced with L-serine (in Homo sapiens)
L-proline 252 replaced with L-serine (in Homo sapiens)
L-proline 252 replaced with L-threonine
L-proline 253 replaced with L-arginine
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 253 replaced with L-arginine (in Homo sapiens)
L-proline 255 replaced with L-serine
L-proline 259 replaced with L-arginine
L-proline 264 replaced with L-serine
L-proline 281 replaced with L-leucine
L-proline 293 replaced with L-leucine
L-proline 293 replaced with L-leucine (in Homo sapiens)
L-proline 293 replaced with L-leucine (in Homo sapiens)
L-proline 293 replaced with L-leucine (in Homo sapiens)
L-proline 293 replaced with L-leucine (in Homo sapiens)
L-proline 293 replaced with L-leucine (in Homo sapiens)
L-proline 293 replaced with L-leucine (in Homo sapiens)
L-proline 293 replaced with L-leucine (in Homo sapiens)
L-proline 293 replaced with L-leucine (in Homo sapiens)
L-proline 293 replaced with L-leucine (in Homo sapiens)
L-proline 293 replaced with L-leucine (in Homo sapiens)
L-proline 293 replaced with L-leucine (in Homo sapiens)
L-proline 301 replaced with L-leucine
L-proline 307 replaced with L-leucine
L-proline 314 replaced with L-leucine
L-proline 327 replaced with L-glutamine
L-proline 327 replaced with L-glutamine (in Homo sapiens)
L-proline 327 replaced with L-glutamine (in Homo sapiens)
L-proline 327 replaced with L-glutamine (in Homo sapiens)
L-proline 327 replaced with L-glutamine (in Homo sapiens)
L-proline 327 replaced with L-glutamine (in Homo sapiens)
L-proline 327 replaced with L-glutamine (in Homo sapiens)
L-proline 327 replaced with L-glutamine (in Homo sapiens)
L-proline 327 replaced with L-glutamine (in Homo sapiens)
L-proline 327 replaced with L-glutamine (in Homo sapiens)
L-proline 327 replaced with L-glutamine (in Homo sapiens)
L-proline 327 replaced with L-glutamine (in Homo sapiens)
L-proline 327 replaced with L-glutamine (in Homo sapiens)
L-proline 327 replaced with L-glutamine (in Homo sapiens)
L-proline 327 replaced with L-glutamine (in Homo sapiens)
L-proline 327 replaced with L-glutamine (in Homo sapiens)
L-proline 327 replaced with L-glutamine (in Homo sapiens)
L-proline 327 replaced with L-glutamine (in Homo sapiens)
L-proline 354 replaced with L-leucine
L-proline 377 replaced with L-serine
L-proline 382 replaced with L-serine
L-proline 52 replaced with L-aspartic acid
L-proline 52 replaced with L-leucine
L-proline 52 replaced with L-lysine
L-proline 52 replaced with L-lysine (in Homo sapiens)
L-proline 52 replaced with L-lysine (in Homo sapiens)
L-proline 52 replaced with L-lysine (in Homo sapiens)
L-proline 52 replaced with L-lysine (in Homo sapiens)
L-proline 52 replaced with L-lysine (in Homo sapiens)
L-proline 52 replaced with L-lysine (in Homo sapiens)
L-proline 52 replaced with L-lysine (in Homo sapiens)
L-proline 52 replaced with L-lysine (in Homo sapiens)
L-proline 52 replaced with L-lysine (in Homo sapiens)
L-proline 52 replaced with L-lysine (in Homo sapiens)
L-proline 52 replaced with L-lysine (in Homo sapiens)
L-proline 52 replaced with L-lysine (in Homo sapiens)
L-proline 533 replaced with L-arginine
L-proline 539 replaced with L-arginine
L-proline 65 replaced with L-leucine
L-proline 753 replaced with L-serine
L-proline 753 replaced with L-serine (in Homo sapiens)
L-proline 753 replaced with L-serine (in Homo sapiens)
L-proline 753 replaced with L-serine (in Homo sapiens)
L-proline 753 replaced with L-serine (in Homo sapiens)
L-proline 753 replaced with L-serine (in Homo sapiens)
L-proline 753 replaced with L-serine (in Homo sapiens)
L-proline 753 replaced with L-serine (in Homo sapiens)
L-proline 753 replaced with L-serine (in Homo sapiens)
L-proline 753 replaced with L-serine (in Homo sapiens)
L-proline 753 replaced with L-serine (in Homo sapiens)
L-proline 753 replaced with L-serine (in Homo sapiens)
L-proline 753 replaced with L-serine (in Homo sapiens)
L-proline 753 replaced with L-serine (in Homo sapiens)
L-proline 753 replaced with L-serine (in Homo sapiens)
L-proline 753 replaced with L-serine (in Homo sapiens)
L-proline 753 replaced with L-serine (in Homo sapiens)
L-proline 83 replaced with L-leucine
L-proline 83 replaced with L-serine
L-proline 90 replaced with L-leucine
L-proline 90 replaced with L-leucine (in Homo sapiens)
L-proline 90 replaced with L-leucine (in Homo sapiens)
L-proline 90 replaced with L-leucine (in Homo sapiens)
L-proline 90 replaced with L-leucine (in Homo sapiens)
L-proline 90 replaced with L-leucine (in Homo sapiens)
L-proline 90 replaced with L-leucine (in Homo sapiens)
L-proline 90 replaced with L-leucine (in Homo sapiens)
L-proline 90 replaced with L-leucine (in Homo sapiens)
L-proline 90 replaced with L-leucine (in Homo sapiens)
L-proline 90 replaced with L-leucine (in Homo sapiens)
L-proline 90 replaced with L-leucine (in Homo sapiens)
L-proline residue 305 replaced with L-glutamine
L-proline residue 305 replaced with L-leucine
L-proline residue 305 replaced with L-leucine (in Homo sapiens)
L-proline residue 305 replaced with L-leucine (in Homo sapiens)
L-proline residue 305 replaced with L-leucine (in Homo sapiens)
L-proline residue 305 replaced with L-leucine (in Homo sapiens)
L-proline residue 305 replaced with L-leucine (in Homo sapiens)
L-proline residue 305 replaced with L-leucine (in Homo sapiens)
L-proline residue 305 replaced with L-leucine (in Homo sapiens)
L-proline residue 305 replaced with L-leucine (in Homo sapiens)
L-proline residue 305 replaced with L-leucine (in Homo sapiens)
L-proline residue 305 replaced with L-leucine (in Homo sapiens)
L-proline residue 305 replaced with L-leucine (in Homo sapiens)
L-proline residue 305 replaced with L-leucine (in Homo sapiens)
L-proline residue 305 replaced with L-leucine (in Homo sapiens)
L-proline residue 305 replaced with L-leucine (in Homo sapiens)
L-proline residue 305 replaced with L-leucine (in Homo sapiens)
L-proline residue 305 replaced with L-leucine (in Homo sapiens)
L-proline residue 305 replaced with L-leucine (in Homo sapiens)
L-proline residue 305 replaced with L-leucine (in Homo sapiens)
L-proline residue 356 replaced with L-arginine
L-proline residue 356 replaced with L-leucine
L-proline residue 356 replaced with L-leucine (in Homo sapiens)
L-proline residue 356 replaced with L-leucine (in Homo sapiens)
L-proline residue 356 replaced with L-leucine (in Homo sapiens)
L-proline residue 356 replaced with L-leucine (in Homo sapiens)
L-proline residue 356 replaced with L-leucine (in Homo sapiens)
L-proline residue 356 replaced with L-leucine (in Homo sapiens)
L-proline residue 356 replaced with L-leucine (in Homo sapiens)
L-proline residue 356 replaced with L-leucine (in Homo sapiens)
L-proline residue 356 replaced with L-leucine (in Homo sapiens)
L-proline residue 356 replaced with L-leucine (in Homo sapiens)
L-proline residue 356 replaced with L-leucine (in Homo sapiens)
L-proline residue 356 replaced with L-leucine (in Homo sapiens)
L-proline residue 356 replaced with L-leucine (in Homo sapiens)
L-proline residue 356 replaced with L-leucine (in Homo sapiens)
L-proline residue 356 replaced with L-leucine (in Homo sapiens)
L-proline residue 356 replaced with L-leucine (in Homo sapiens)
L-proline residue 356 replaced with L-leucine (in Homo sapiens)
L-proline residue 356 replaced with L-leucine (in Homo sapiens)
L-proline residue 356 replaced with L-leucine (in Homo sapiens)
L-serine 106 replaced with L-proline
L-serine 137 replaced with L-proline
L-serine 137 replaced with L-proline (in Homo sapiens)
L-serine 137 replaced with L-proline (in Homo sapiens)
L-serine 137 replaced with L-proline (in Homo sapiens)
L-serine 137 replaced with L-proline (in Homo sapiens)
L-serine 137 replaced with L-proline (in Homo sapiens)
L-serine 137 replaced with L-proline (in Homo sapiens)
L-serine 137 replaced with L-proline (in Homo sapiens)
L-serine 137 replaced with L-proline (in Homo sapiens)
L-serine 139 replaced with L-alanine
L-serine 139 replaced with L-alanine (in Homo sapiens)
L-serine 139 replaced with L-alanine (in Homo sapiens)
L-serine 139 replaced with L-alanine (in Homo sapiens)
L-serine 139 replaced with L-alanine (in Homo sapiens)
L-serine 139 replaced with L-alanine (in Homo sapiens)
L-serine 139 replaced with L-alanine (in Homo sapiens)
L-serine 139 replaced with L-alanine (in Homo sapiens)
L-serine 139 replaced with L-alanine (in Homo sapiens)
L-serine 140 replaced with L-leucine
L-serine 140 replaced with L-leucine (in Homo sapiens)
L-serine 140 replaced with L-leucine (in Homo sapiens)
L-serine 140 replaced with L-leucine (in Homo sapiens)
L-serine 140 replaced with L-leucine (in Homo sapiens)
L-serine 140 replaced with L-leucine (in Homo sapiens)
L-serine 140 replaced with L-leucine (in Homo sapiens)
L-serine 140 replaced with L-leucine (in Homo sapiens)
L-serine 140 replaced with L-leucine (in Homo sapiens)
L-serine 150 replaced with L-arginine
L-serine 150 replaced with L-glutamine
L-serine 150 replaced with L-glutamine (in Homo sapiens)
L-serine 150 replaced with L-glutamine (in Homo sapiens)
L-serine 150 replaced with L-glutamine (in Homo sapiens)
L-serine 150 replaced with L-glutamine (in Homo sapiens)
L-serine 150 replaced with L-glutamine (in Homo sapiens)
L-serine 150 replaced with L-glutamine (in Homo sapiens)
L-serine 150 replaced with L-glutamine (in Homo sapiens)
L-serine 150 replaced with L-glutamine (in Homo sapiens)
L-serine 156 replaced with L-alanine
L-serine 156 replaced with L-alanine (in Homo sapiens)
L-serine 156 replaced with L-alanine (in Homo sapiens)
L-serine 156 replaced with L-alanine (in Homo sapiens)
L-serine 156 replaced with L-alanine (in Homo sapiens)
L-serine 156 replaced with L-alanine (in Homo sapiens)
L-serine 156 replaced with L-alanine (in Homo sapiens)
L-serine 156 replaced with L-alanine (in Homo sapiens)
L-serine 156 replaced with L-alanine (in Homo sapiens)
L-serine 170 replaced with glycine
L-serine 170 replaced with L-arginine
L-serine 170 replaced with L-asparagine
L-serine 170 replaced with L-asparagine (in Homo sapiens)
L-serine 170 replaced with L-asparagine (in Homo sapiens)
L-serine 170 replaced with L-asparagine (in Homo sapiens)
L-serine 170 replaced with L-asparagine (in Homo sapiens)
L-serine 170 replaced with L-asparagine (in Homo sapiens)
L-serine 170 replaced with L-asparagine (in Homo sapiens)
L-serine 170 replaced with L-asparagine (in Homo sapiens)
L-serine 170 replaced with L-asparagine (in Homo sapiens)
L-serine 170 replaced with L-asparagine (in Homo sapiens)
L-serine 170 replaced with L-asparagine (in Homo sapiens)
L-serine 170 replaced with L-asparagine (in Homo sapiens)
L-serine 170 replaced with L-asparagine (in Homo sapiens)
L-serine 170 replaced with L-asparagine (in Homo sapiens)
L-serine 170 replaced with L-asparagine (in Homo sapiens)
L-serine 170 replaced with L-asparagine (in Homo sapiens)
L-serine 170 replaced with L-asparagine (in Homo sapiens)
L-serine 170 replaced with L-asparagine (in Homo sapiens)
L-serine 170 replaced with L-asparagine (in Homo sapiens)
L-serine 170 replaced with L-asparagine (in Homo sapiens)
L-serine 170 replaced with L-asparagine (in Homo sapiens)
L-serine 170 replaced with L-asparagine (in Homo sapiens)
L-serine 170 replaced with L-asparagine (in Homo sapiens)
L-serine 170 replaced with L-asparagine (in Homo sapiens)
L-serine 170 replaced with L-asparagine (in Homo sapiens)
L-serine 170 replaced with L-asparagine (in Homo sapiens)
L-serine 170 replaced with L-asparagine (in Homo sapiens)
L-serine 170 replaced with L-asparagine (in Homo sapiens)
L-serine 170 replaced with L-isoleucine
L-serine 175 replaced with L-arginine
L-serine 20 replaced with unknown
L-serine 20 replaced with unknown (in Homo sapiens)
L-serine 20 replaced with unknown (in Homo sapiens)
L-serine 20 replaced with unknown (in Homo sapiens)
L-serine 20 replaced with unknown (in Homo sapiens)
L-serine 20 replaced with unknown (in Homo sapiens)
L-serine 20 replaced with unknown (in Homo sapiens)
L-serine 20 replaced with unknown (in Homo sapiens)
L-serine 20 replaced with unknown (in Homo sapiens)
L-serine 20 replaced with unknown (in Homo sapiens)
L-serine 20 replaced with unknown (in Homo sapiens)
L-serine 20 replaced with unknown (in Homo sapiens)
L-serine 20 replaced with unknown (in Homo sapiens)
L-serine 20 replaced with unknown (in Homo sapiens)
L-serine 20 replaced with unknown (in Homo sapiens)
L-serine 20 replaced with unknown (in Homo sapiens)
L-serine 20 replaced with unknown (in Homo sapiens)
L-serine 20 replaced with unknown (in Homo sapiens)
L-serine 20 replaced with unknown (in Homo sapiens)
L-serine 210 replaced with unknown
L-serine 210 replaced with unknown (in Homo sapiens)
L-serine 210 replaced with unknown (in Homo sapiens)
L-serine 210 replaced with unknown (in Homo sapiens)
L-serine 210 replaced with unknown (in Homo sapiens)
L-serine 210 replaced with unknown (in Homo sapiens)
L-serine 210 replaced with unknown (in Homo sapiens)
L-serine 214 replaced with L-proline
L-serine 249 replaced with L-cysteine
L-serine 249 replaced with L-cysteine (in Homo sapiens)
L-serine 249 replaced with L-cysteine (in Homo sapiens)
L-serine 249 replaced with L-cysteine (in Homo sapiens)
L-serine 249 replaced with L-cysteine (in Homo sapiens)
L-serine 249 replaced with L-cysteine (in Homo sapiens)
L-serine 249 replaced with L-cysteine (in Homo sapiens)
L-serine 249 replaced with L-cysteine (in Homo sapiens)
L-serine 249 replaced with L-cysteine (in Homo sapiens)
L-serine 249 replaced with L-cysteine (in Homo sapiens)
L-serine 249 replaced with L-cysteine (in Homo sapiens)
L-serine 249 replaced with L-cysteine (in Homo sapiens)
L-serine 249 replaced with L-cysteine (in Homo sapiens)
L-serine 249 replaced with L-cysteine (in Homo sapiens)
L-serine 249 replaced with L-cysteine (in Homo sapiens)
L-serine 249 replaced with L-cysteine (in Homo sapiens)
L-serine 249 replaced with L-cysteine (in Homo sapiens)
L-serine 249 replaced with L-cysteine (in Homo sapiens)
L-serine 249 replaced with L-cysteine (in Homo sapiens)
L-serine 249 replaced with L-cysteine (in Homo sapiens)
L-serine 249 replaced with L-cysteine (in Homo sapiens)
L-serine 249 replaced with L-cysteine (in Homo sapiens)
L-serine 249 replaced with L-cysteine (in Homo sapiens)
L-serine 249 replaced with L-cysteine (in Homo sapiens)
L-serine 249 replaced with L-cysteine (in Homo sapiens)
L-serine 249 replaced with L-cysteine (in Homo sapiens)
L-serine 2516 replaced with L-proline
L-serine 2516 replaced with L-proline (in Homo sapiens)
L-serine 2516 replaced with L-proline (in Homo sapiens)
L-serine 2516 replaced with L-proline (in Homo sapiens)
L-serine 2516 replaced with L-proline (in Homo sapiens)
L-serine 2516 replaced with L-proline (in Homo sapiens)
L-serine 2516 replaced with L-proline (in Homo sapiens)
L-serine 2516 replaced with L-proline (in Homo sapiens)
L-serine 2516 replaced with L-proline (in Homo sapiens)
L-serine 2516 replaced with L-proline (in Homo sapiens)
L-serine 2516 replaced with L-proline (in Homo sapiens)
L-serine 2516 replaced with L-proline (in Homo sapiens)
L-serine 2516 replaced with L-proline (in Homo sapiens)
L-serine 2516 replaced with L-proline (in Homo sapiens)
L-serine 2516 replaced with L-proline (in Homo sapiens)
L-serine 2516 replaced with L-proline (in Homo sapiens)
L-serine 252 replaced with L-tryptophan
L-serine 252 replaced with L-tryptophan
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 252 replaced with L-tryptophan (in Homo sapiens)
L-serine 258 replaced with L-leucine
L-serine 267 replaced with L-proline
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 267 replaced with L-proline (in Homo sapiens)
L-serine 290 replaced with L-phenylalanine
L-serine 323 replaced with L-arginine
L-serine 33 replaced with L-cysteine
L-serine 33 replaced with L-cysteine (in Homo sapiens)
L-serine 33 replaced with L-cysteine (in Homo sapiens)
L-serine 33 replaced with L-cysteine (in Homo sapiens)
L-serine 33 replaced with L-cysteine (in Homo sapiens)
L-serine 33 replaced with L-cysteine (in Homo sapiens)
L-serine 33 replaced with L-cysteine (in Homo sapiens)
L-serine 33 replaced with L-cysteine (in Homo sapiens)
L-serine 33 replaced with L-cysteine (in Homo sapiens)
L-serine 33 replaced with L-cysteine (in Homo sapiens)
L-serine 33 replaced with L-cysteine (in Homo sapiens)
L-serine 33 replaced with L-cysteine (in Homo sapiens)
L-serine 33 replaced with L-cysteine (in Homo sapiens)
L-serine 33 replaced with L-cysteine (in Homo sapiens)
L-serine 33 replaced with L-phenylalanine
L-serine 33 replaced with L-proline
L-serine 33 replaced with L-tyrosine
L-serine 363 replaced with L-phenylalanine
L-serine 37 replaced with L-alanine
L-serine 37 replaced with L-alanine (in Homo sapiens)
L-serine 37 replaced with L-alanine (in Homo sapiens)
L-serine 37 replaced with L-alanine (in Homo sapiens)
L-serine 37 replaced with L-alanine (in Homo sapiens)
L-serine 37 replaced with L-alanine (in Homo sapiens)
L-serine 37 replaced with L-alanine (in Homo sapiens)
L-serine 37 replaced with L-alanine (in Homo sapiens)
L-serine 37 replaced with L-alanine (in Homo sapiens)
L-serine 37 replaced with L-alanine (in Homo sapiens)
L-serine 37 replaced with L-alanine (in Homo sapiens)
L-serine 37 replaced with L-alanine (in Homo sapiens)
L-serine 37 replaced with L-alanine (in Homo sapiens)
L-serine 37 replaced with L-alanine (in Homo sapiens)
L-serine 37 replaced with L-cysteine
L-serine 37 replaced with L-phenylalanine
L-serine 371 replaced with L-cysteine
L-serine 371 replaced with L-cysteine (in Homo sapiens)
L-serine 371 replaced with L-cysteine (in Homo sapiens)
L-serine 371 replaced with L-cysteine (in Homo sapiens)
L-serine 371 replaced with L-cysteine (in Homo sapiens)
L-serine 371 replaced with L-cysteine (in Homo sapiens)
L-serine 371 replaced with L-cysteine (in Homo sapiens)
L-serine 371 replaced with L-cysteine (in Homo sapiens)
L-serine 371 replaced with L-cysteine (in Homo sapiens)
L-serine 371 replaced with L-cysteine (in Homo sapiens)
L-serine 371 replaced with L-cysteine (in Homo sapiens)
L-serine 371 replaced with L-cysteine (in Homo sapiens)
L-serine 371 replaced with L-cysteine (in Homo sapiens)
L-serine 371 replaced with L-cysteine (in Homo sapiens)
L-serine 371 replaced with L-cysteine (in Homo sapiens)
L-serine 371 replaced with L-cysteine (in Homo sapiens)
L-serine 371 replaced with L-cysteine (in Homo sapiens)
L-serine 371 replaced with L-cysteine (in Homo sapiens)
L-serine 371 replaced with L-cysteine (in Homo sapiens)
L-serine 371 replaced with L-cysteine (in Homo sapiens)
L-serine 371 replaced with L-cysteine (in Homo sapiens)
L-serine 371 replaced with L-cysteine (in Homo sapiens)
L-serine 371 replaced with L-cysteine (in Homo sapiens)
L-serine 371 replaced with L-cysteine (in Homo sapiens)
L-serine 371 replaced with L-cysteine (in Homo sapiens)
L-serine 371 replaced with L-cysteine (in Homo sapiens)
L-serine 372 replaced with L-cysteine
L-serine 373 replaced with L-cysteine
L-serine 376 replaced with L-phenylalanine
L-serine 376 replaced with L-phenylalanine
L-serine 40 replaced with L-leucine
L-serine 40 replaced with L-leucine (in Homo sapiens)
L-serine 40 replaced with L-leucine (in Homo sapiens)
L-serine 40 replaced with L-leucine (in Homo sapiens)
L-serine 40 replaced with L-leucine (in Homo sapiens)
L-serine 40 replaced with L-leucine (in Homo sapiens)
L-serine 40 replaced with L-leucine (in Homo sapiens)
L-serine 40 replaced with L-leucine (in Homo sapiens)
L-serine 40 replaced with L-leucine (in Homo sapiens)
L-serine 40 replaced with L-leucine (in Homo sapiens)
L-serine 40 replaced with L-leucine (in Homo sapiens)
L-serine 40 replaced with L-leucine (in Homo sapiens)
L-serine 40 replaced with L-leucine (in Homo sapiens)
L-serine 40 replaced with L-leucine (in Homo sapiens)
L-serine 438 replaced with unknown
L-serine 45 replaced with L-phenylalanine
L-serine 45 replaced with L-phenylalanine (in Homo sapiens)
L-serine 45 replaced with L-phenylalanine (in Homo sapiens)
L-serine 45 replaced with L-phenylalanine (in Homo sapiens)
L-serine 45 replaced with L-phenylalanine (in Homo sapiens)
L-serine 45 replaced with L-phenylalanine (in Homo sapiens)
L-serine 45 replaced with L-phenylalanine (in Homo sapiens)
L-serine 45 replaced with L-phenylalanine (in Homo sapiens)
L-serine 45 replaced with L-phenylalanine (in Homo sapiens)
L-serine 45 replaced with L-phenylalanine (in Homo sapiens)
L-serine 45 replaced with L-phenylalanine (in Homo sapiens)
L-serine 45 replaced with L-phenylalanine (in Homo sapiens)
L-serine 45 replaced with L-phenylalanine (in Homo sapiens)
L-serine 45 replaced with L-phenylalanine (in Homo sapiens)
L-serine 45 replaced with L-proline
L-serine 451 replaced with L-alanine
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 451 replaced with L-alanine (in Homo sapiens)
L-serine 452 replaced with L-alanine
L-serine 454 replaced with L-leucine
L-serine 464 replaced with unknown
L-serine 464 replaced with unknown (in Homo sapiens)
L-serine 464 replaced with unknown (in Homo sapiens)
L-serine 464 replaced with unknown (in Homo sapiens)
L-serine 464 replaced with unknown (in Homo sapiens)
L-serine 464 replaced with unknown (in Homo sapiens)
L-serine 464 replaced with unknown (in Homo sapiens)
L-serine 464 replaced with unknown (in Homo sapiens)
L-serine 464 replaced with unknown (in Homo sapiens)
L-serine 464 replaced with unknown (in Homo sapiens)
L-serine 464 replaced with unknown (in Homo sapiens)
L-serine 464 replaced with unknown (in Homo sapiens)
L-serine 464 replaced with unknown (in Homo sapiens)
L-serine 464 replaced with unknown (in Homo sapiens)
L-serine 464 replaced with unknown (in Homo sapiens)
L-serine 464 replaced with unknown (in Homo sapiens)
L-serine 464 replaced with unknown (in Homo sapiens)
L-serine 464 replaced with unknown (in Homo sapiens)
L-serine 464 replaced with unknown (in Homo sapiens)
L-serine 478 replaced with L-proline
L-serine 518 replaced with L-phenylalanine
L-serine 52 replaced with L-phenylalanine
L-serine 66 replaced with L-tryptophan
L-serine 752 replaced with L-valine
L-serine 811 replaced with unknown
L-serine 811 replaced with unknown (in Homo sapiens)
L-serine 811 replaced with unknown (in Homo sapiens)
L-serine 811 replaced with unknown (in Homo sapiens)
L-serine 811 replaced with unknown (in Homo sapiens)
L-serine 811 replaced with unknown (in Homo sapiens)
L-serine 811 replaced with unknown (in Homo sapiens)
L-serine 811 replaced with unknown (in Homo sapiens)
L-serine 811 replaced with unknown (in Homo sapiens)
L-serine 811 replaced with unknown (in Homo sapiens)
L-serine 811 replaced with unknown (in Homo sapiens)
L-serine 811 replaced with unknown (in Homo sapiens)
L-serine 811 replaced with unknown (in Homo sapiens)
L-serine 811 replaced with unknown (in Homo sapiens)
L-serine 811 replaced with unknown (in Homo sapiens)
L-serine 811 replaced with unknown (in Homo sapiens)
L-serine 811 replaced with unknown (in Homo sapiens)
L-serine 811 replaced with unknown (in Homo sapiens)
L-serine 811 replaced with unknown (in Homo sapiens)
L-serine 811 replaced with unknown (in Homo sapiens)
L-serine 811 replaced with unknown (in Homo sapiens)
L-serine 811 replaced with unknown (in Homo sapiens)
L-serine 811 replaced with unknown (in Homo sapiens)
L-serine 811 replaced with unknown (in Homo sapiens)
L-serine 94 replaced with L-isoleucine
L-serine residue 425 replaced with L-cysteine
L-serine residue 425 replaced with L-cysteine (in Homo sapiens)
L-serine residue 425 replaced with L-cysteine (in Homo sapiens)
L-serine residue 425 replaced with L-cysteine (in Homo sapiens)
L-serine residue 425 replaced with L-cysteine (in Homo sapiens)
L-serine residue 425 replaced with L-cysteine (in Homo sapiens)
L-serine residue 425 replaced with L-cysteine (in Homo sapiens)
L-serine residue 425 replaced with L-cysteine (in Homo sapiens)
L-serine residue 425 replaced with L-cysteine (in Homo sapiens)
L-serine residue 425 replaced with L-cysteine (in Homo sapiens)
L-serine residue 425 replaced with L-cysteine (in Homo sapiens)
L-serine residue 425 replaced with L-cysteine (in Homo sapiens)
L-serine residue 425 replaced with L-cysteine (in Homo sapiens)
L-serine residue 425 replaced with L-cysteine (in Homo sapiens)
L-serine residue 425 replaced with L-cysteine (in Homo sapiens)
L-serine residue 425 replaced with L-cysteine (in Homo sapiens)
L-serine residue 464 replaced with L-leucine
L-serine residue 467 replaced with L-proline
L-threonine 132 replaced with L-leucine
L-threonine 132 replaced with L-leucine (in Homo sapiens)
L-threonine 132 replaced with L-leucine (in Homo sapiens)
L-threonine 132 replaced with L-leucine (in Homo sapiens)
L-threonine 132 replaced with L-leucine (in Homo sapiens)
L-threonine 132 replaced with L-leucine (in Homo sapiens)
L-threonine 132 replaced with L-leucine (in Homo sapiens)
L-threonine 132 replaced with L-leucine (in Homo sapiens)
L-threonine 132 replaced with L-leucine (in Homo sapiens)
L-threonine 182 replaced with L-asparagine
L-threonine 182 replaced with L-asparagine (in Homo sapiens)
L-threonine 182 replaced with L-asparagine (in Homo sapiens)
L-threonine 182 replaced with L-asparagine (in Homo sapiens)
L-threonine 182 replaced with L-asparagine (in Homo sapiens)
L-threonine 182 replaced with L-asparagine (in Homo sapiens)
L-threonine 182 replaced with L-asparagine (in Homo sapiens)
L-threonine 182 replaced with L-asparagine (in Homo sapiens)
L-threonine 182 replaced with L-asparagine (in Homo sapiens)
L-threonine 182 replaced with L-asparagine (in Homo sapiens)
L-threonine 182 replaced with L-asparagine (in Homo sapiens)
L-threonine 182 replaced with L-asparagine (in Homo sapiens)
L-threonine 182 replaced with L-asparagine (in Homo sapiens)
L-threonine 182 replaced with L-asparagine (in Homo sapiens)
L-threonine 182 replaced with L-asparagine (in Homo sapiens)
L-threonine 182 replaced with L-asparagine (in Homo sapiens)
L-threonine 182 replaced with L-asparagine (in Homo sapiens)
L-threonine 182 replaced with L-asparagine (in Homo sapiens)
L-threonine 182 replaced with L-asparagine (in Homo sapiens)
L-threonine 185 replaced with L-isoleucine
L-threonine 194 replaced with L-isoleucine
L-threonine 263 replaced with L-proline
L-threonine 297 replaced with L-alanine
L-threonine 318 replaced with L-methionine
L-threonine 321 replaced with L-proline
L-threonine 321 replaced with L-proline (in Homo sapiens)
L-threonine 321 replaced with L-proline (in Homo sapiens)
L-threonine 321 replaced with L-proline (in Homo sapiens)
L-threonine 321 replaced with L-proline (in Homo sapiens)
L-threonine 321 replaced with L-proline (in Homo sapiens)
L-threonine 321 replaced with L-proline (in Homo sapiens)
L-threonine 321 replaced with L-proline (in Homo sapiens)
L-threonine 321 replaced with L-proline (in Homo sapiens)
L-threonine 321 replaced with L-proline (in Homo sapiens)
L-threonine 321 replaced with L-proline (in Homo sapiens)
L-threonine 321 replaced with L-proline (in Homo sapiens)
L-threonine 339 replaced with L-methionine
L-threonine 41 replaced with L-alanine
L-threonine 41 replaced with L-isoleucine
L-threonine 41 replaced with L-isoleucine
L-threonine 41 replaced with L-isoleucine (in Homo sapiens)
L-threonine 41 replaced with L-isoleucine (in Homo sapiens)
L-threonine 41 replaced with L-isoleucine (in Homo sapiens)
L-threonine 41 replaced with L-isoleucine (in Homo sapiens)
L-threonine 41 replaced with L-isoleucine (in Homo sapiens)
L-threonine 41 replaced with L-isoleucine (in Homo sapiens)
L-threonine 41 replaced with L-isoleucine (in Homo sapiens)
L-threonine 41 replaced with L-isoleucine (in Homo sapiens)
L-threonine 41 replaced with L-isoleucine (in Homo sapiens)
L-threonine 41 replaced with L-isoleucine (in Homo sapiens)
L-threonine 41 replaced with L-isoleucine (in Homo sapiens)
L-threonine 41 replaced with L-isoleucine (in Homo sapiens)
L-threonine 41 replaced with L-isoleucine (in Homo sapiens)
L-threonine 47 replaced with L-proline
L-threonine 48 replaced with L-arginine
L-threonine 498 replaced with L-alanine
L-threonine 54 replaced with L-threonine - L-arginine - L-arginine
L-threonine 54 replaced with L-threonine - L-arginine - L-arginine (in Homo sapiens)
L-threonine 54 replaced with L-threonine - L-arginine - L-arginine (in Homo sapiens)
L-threonine 54 replaced with L-threonine - L-arginine - L-arginine (in Homo sapiens)
L-threonine 54 replaced with L-threonine - L-arginine - L-arginine (in Homo sapiens)
L-threonine 54 replaced with L-threonine - L-arginine - L-arginine (in Homo sapiens)
L-threonine 54 replaced with L-threonine - L-arginine - L-arginine (in Homo sapiens)
L-threonine 54 replaced with L-threonine - L-arginine - L-arginine (in Homo sapiens)
L-threonine 54 replaced with L-threonine - L-arginine - L-arginine (in Homo sapiens)
L-threonine 54 replaced with L-threonine - L-arginine - L-arginine (in Homo sapiens)
L-threonine 54 replaced with L-threonine - L-arginine - L-arginine (in Homo sapiens)
L-threonine 54 replaced with L-threonine - L-arginine - L-arginine (in Homo sapiens)
L-threonine 54 replaced with L-threonine - L-arginine - L-arginine (in Homo sapiens)
L-threonine 644 replaced with L-methionine
L-threonine 644 replaced with L-methionine (in Homo sapiens)
L-threonine 644 replaced with L-methionine (in Homo sapiens)
L-threonine 644 replaced with L-methionine (in Homo sapiens)
L-threonine 644 replaced with L-methionine (in Homo sapiens)
L-threonine 644 replaced with L-methionine (in Homo sapiens)
L-threonine 644 replaced with L-methionine (in Homo sapiens)
L-threonine 644 replaced with L-methionine (in Homo sapiens)
L-threonine 644 replaced with L-methionine (in Homo sapiens)
L-threonine 644 replaced with L-methionine (in Homo sapiens)
L-threonine 644 replaced with L-methionine (in Homo sapiens)
L-threonine 644 replaced with L-methionine (in Homo sapiens)
L-threonine 65 replaced with L-proline
L-threonine 67 replaced with L-methionine
L-threonine 751 replaced with L-alanine
L-threonine 751 replaced with L-proline
L-threonine 790 replaced with L-methionine
L-threonine 790 replaced with L-methionine (in Homo sapiens)
L-threonine 790 replaced with L-methionine (in Homo sapiens)
L-threonine 790 replaced with L-methionine (in Homo sapiens)
L-threonine 790 replaced with L-methionine (in Homo sapiens)
L-threonine 790 replaced with L-methionine (in Homo sapiens)
L-threonine 790 replaced with L-methionine (in Homo sapiens)
L-threonine 790 replaced with L-methionine (in Homo sapiens)
L-threonine 790 replaced with L-methionine (in Homo sapiens)
L-threonine 790 replaced with L-methionine (in Homo sapiens)
L-threonine 790 replaced with L-methionine (in Homo sapiens)
L-threonine 790 replaced with L-methionine (in Homo sapiens)
L-threonine 790 replaced with L-methionine (in Homo sapiens)
L-threonine 790 replaced with L-methionine (in Homo sapiens)
L-threonine 790 replaced with L-methionine (in Homo sapiens)
L-threonine 790 replaced with L-methionine (in Homo sapiens)
L-threonine 790 replaced with L-methionine (in Homo sapiens)
L-threonine residue 155 replaced with L-proline
L-threonine residue 155 replaced with L-proline (in Homo sapiens)
L-threonine residue 155 replaced with L-proline (in Homo sapiens)
L-threonine residue 155 replaced with L-proline (in Homo sapiens)
L-threonine residue 155 replaced with L-proline (in Homo sapiens)
L-threonine residue 155 replaced with L-proline (in Homo sapiens)
L-threonine residue 155 replaced with L-proline (in Homo sapiens)
L-threonine residue 155 replaced with L-proline (in Homo sapiens)
L-threonine residue 155 replaced with L-proline (in Homo sapiens)
L-threonine residue 74 replaced with unknown
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-threonine residue 74 replaced with unknown (in Homo sapiens)
L-tryptophan 105 replaced with L-arginine
L-tryptophan 112 replaced with unknown
L-tryptophan 117 replaced with glycine
L-tryptophan 117 replaced with L-arginine
L-tryptophan 17 replaced with unknown
L-tryptophan 177 replaced with L-arginine
L-tryptophan 203 replaced with unknown
L-tryptophan 23 replaced with unknown
L-tryptophan 23 replaced with unknown (in Homo sapiens)
L-tryptophan 23 replaced with unknown (in Homo sapiens)
L-tryptophan 23 replaced with unknown (in Homo sapiens)
L-tryptophan 23 replaced with unknown (in Homo sapiens)
L-tryptophan 23 replaced with unknown (in Homo sapiens)
L-tryptophan 23 replaced with unknown (in Homo sapiens)
L-tryptophan 23 replaced with unknown (in Homo sapiens)
L-tryptophan 23 replaced with unknown (in Homo sapiens)
L-tryptophan 23 replaced with unknown (in Homo sapiens)
L-tryptophan 23 replaced with unknown (in Homo sapiens)
L-tryptophan 23 replaced with unknown (in Homo sapiens)
L-tryptophan 242 replaced with unknown
L-tryptophan 242 replaced with unknown (in Homo sapiens)
L-tryptophan 242 replaced with unknown (in Homo sapiens)
L-tryptophan 242 replaced with unknown (in Homo sapiens)
L-tryptophan 242 replaced with unknown (in Homo sapiens)
L-tryptophan 242 replaced with unknown (in Homo sapiens)
L-tryptophan 242 replaced with unknown (in Homo sapiens)
L-tryptophan 242 replaced with unknown (in Homo sapiens)
L-tryptophan 242 replaced with unknown (in Homo sapiens)
L-tryptophan 242 replaced with unknown (in Homo sapiens)
L-tryptophan 242 replaced with unknown (in Homo sapiens)
L-tryptophan 242 replaced with unknown (in Homo sapiens)
L-tryptophan 242 replaced with unknown (in Homo sapiens)
L-tryptophan 242 replaced with unknown (in Homo sapiens)
L-tryptophan 242 replaced with unknown (in Homo sapiens)
L-tryptophan 242 replaced with unknown (in Homo sapiens)
L-tryptophan 242 replaced with unknown (in Homo sapiens)
L-tryptophan 242 replaced with unknown (in Homo sapiens)
L-tryptophan 247 replaced with unknown
L-tryptophan 272 replaced with glycine
L-tryptophan 273 replaced with L-leucine
L-tryptophan 290 replaced with glycine
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with glycine (in Homo sapiens)
L-tryptophan 290 replaced with L-cysteine
L-tryptophan 311 replaced with unknown
L-tryptophan 402 replaced with unknown
L-tryptophan 403 replaced with L-cysteine
L-tryptophan 406 replaced with L-arginine
L-tryptophan 406 replaced with unknown
L-tryptophan 473 replaced with unknown
L-tryptophan 509 replaced with L-cysteine
L-tryptophan 521 replaced with unknown
L-tryptophan 57 replaced with unknown
L-tryptophan 71 replaced with L-arginine
L-tyrosine 110 replaced with L-cysteine
L-tyrosine 140 replaced with unknown
L-tyrosine 140 replaced with unknown (in Homo sapiens)
L-tyrosine 140 replaced with unknown (in Homo sapiens)
L-tyrosine 140 replaced with unknown (in Homo sapiens)
L-tyrosine 140 replaced with unknown (in Homo sapiens)
L-tyrosine 140 replaced with unknown (in Homo sapiens)
L-tyrosine 140 replaced with unknown (in Homo sapiens)
L-tyrosine 140 replaced with unknown (in Homo sapiens)
L-tyrosine 140 replaced with unknown (in Homo sapiens)
L-tyrosine 140 replaced with unknown (in Homo sapiens)
L-tyrosine 140 replaced with unknown (in Homo sapiens)
L-tyrosine 140 replaced with unknown (in Homo sapiens)
L-tyrosine 140 replaced with unknown (in Homo sapiens)
L-tyrosine 140 replaced with unknown (in Homo sapiens)
L-tyrosine 140 replaced with unknown (in Homo sapiens)
L-tyrosine 140 replaced with unknown (in Homo sapiens)
L-tyrosine 140 replaced with unknown (in Homo sapiens)
L-tyrosine 140 replaced with unknown (in Homo sapiens)
L-tyrosine 140 replaced with unknown (in Homo sapiens)
L-tyrosine 143 replaced with L-cysteine
L-tyrosine 153 replaced with L-isoleucine
L-tyrosine 153 replaced with L-isoleucine (in Homo sapiens)
L-tyrosine 153 replaced with L-isoleucine (in Homo sapiens)
L-tyrosine 153 replaced with L-isoleucine (in Homo sapiens)
L-tyrosine 153 replaced with L-isoleucine (in Homo sapiens)
L-tyrosine 153 replaced with L-isoleucine (in Homo sapiens)
L-tyrosine 153 replaced with L-isoleucine (in Homo sapiens)
L-tyrosine 153 replaced with L-isoleucine (in Homo sapiens)
L-tyrosine 153 replaced with L-isoleucine (in Homo sapiens)
L-tyrosine 170 replaced with L-cysteine
L-tyrosine 201 replaced with unknown
L-tyrosine 207 replaced with L-cysteine
L-tyrosine 222 replaced with unknown
L-tyrosine 226 replaced with L-cysteine
L-tyrosine 240 replaced with L-cysteine
L-tyrosine 249 replaced with L-cysteine
L-tyrosine 249 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 249 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 249 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 249 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 249 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 249 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 249 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 249 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 249 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 249 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 249 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 249 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 249 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 249 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 249 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 249 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 249 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 249 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 275 replaced with unknown
L-tyrosine 279 replaced with L-serine
L-tyrosine 286 replaced with L-cysteine
L-tyrosine 293 replaced with L-cysteine
L-tyrosine 346 replaced with unknown
L-tyrosine 346 replaced with unknown (in Homo sapiens)
L-tyrosine 346 replaced with unknown (in Homo sapiens)
L-tyrosine 346 replaced with unknown (in Homo sapiens)
L-tyrosine 346 replaced with unknown (in Homo sapiens)
L-tyrosine 346 replaced with unknown (in Homo sapiens)
L-tyrosine 346 replaced with unknown (in Homo sapiens)
L-tyrosine 346 replaced with unknown (in Homo sapiens)
L-tyrosine 346 replaced with unknown (in Homo sapiens)
L-tyrosine 346 replaced with unknown (in Homo sapiens)
L-tyrosine 346 replaced with unknown (in Homo sapiens)
L-tyrosine 346 replaced with unknown (in Homo sapiens)
L-tyrosine 346 replaced with unknown (in Homo sapiens)
L-tyrosine 346 replaced with unknown (in Homo sapiens)
L-tyrosine 367 replaced with L-cysteine
L-tyrosine 367 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 367 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 367 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 367 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 367 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 367 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 367 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 367 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 367 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 367 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 367 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 367 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 367 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 367 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 367 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 367 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 367 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 367 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 367 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 367 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 367 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 367 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 373 replaced with L-cysteine
L-tyrosine 373 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 373 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 373 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 373 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 373 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 373 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 373 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 373 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 373 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 373 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 373 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 373 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 373 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 373 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 373 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 373 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 373 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 373 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 373 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 373 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 373 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 373 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 373 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 373 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 373 replaced with L-cysteine (in Homo sapiens)
L-tyrosine 375 replaced with L-cysteine
L-tyrosine 376 replaced with L-cysteine
L-tyrosine 414 replaced with unknown
L-tyrosine 470 replaced with L-aspartic acid
L-tyrosine 470 replaced with L-aspartic acid (in Homo sapiens)
L-tyrosine 470 replaced with L-aspartic acid (in Homo sapiens)
L-tyrosine 470 replaced with L-aspartic acid (in Homo sapiens)
L-tyrosine 470 replaced with L-aspartic acid (in Homo sapiens)
L-tyrosine 470 replaced with L-aspartic acid (in Homo sapiens)
L-tyrosine 470 replaced with L-aspartic acid (in Homo sapiens)
L-tyrosine 470 replaced with L-aspartic acid (in Homo sapiens)
L-tyrosine 470 replaced with L-aspartic acid (in Homo sapiens)
L-tyrosine 470 replaced with L-aspartic acid (in Homo sapiens)
L-tyrosine 470 replaced with L-aspartic acid (in Homo sapiens)
L-tyrosine 470 replaced with L-aspartic acid (in Homo sapiens)
L-tyrosine 83 replaced with L-cysteine
L-valine 1089 replaced with L-isoleucine
L-valine 117 replaced with L-isoleucine
L-valine 1576 replaced with L-glutamic acid
L-valine 1576 replaced with L-glutamic acid (in Homo sapiens)
L-valine 1576 replaced with L-glutamic acid (in Homo sapiens)
L-valine 1576 replaced with L-glutamic acid (in Homo sapiens)
L-valine 1576 replaced with L-glutamic acid (in Homo sapiens)
L-valine 1576 replaced with L-glutamic acid (in Homo sapiens)
L-valine 1576 replaced with L-glutamic acid (in Homo sapiens)
L-valine 1576 replaced with L-glutamic acid (in Homo sapiens)
L-valine 1576 replaced with L-glutamic acid (in Homo sapiens)
L-valine 1576 replaced with L-glutamic acid (in Homo sapiens)
L-valine 1576 replaced with L-glutamic acid (in Homo sapiens)
L-valine 1576 replaced with L-glutamic acid (in Homo sapiens)
L-valine 1576 replaced with L-glutamic acid (in Homo sapiens)
L-valine 1576 replaced with L-glutamic acid (in Homo sapiens)
L-valine 1576 replaced with L-glutamic acid (in Homo sapiens)
L-valine 1576 replaced with L-glutamic acid (in Homo sapiens)
L-valine 1676 replaced with L-aspartic acid
L-valine 1676 replaced with L-aspartic acid (in Homo sapiens)
L-valine 1676 replaced with L-aspartic acid (in Homo sapiens)
L-valine 1676 replaced with L-aspartic acid (in Homo sapiens)
L-valine 1676 replaced with L-aspartic acid (in Homo sapiens)
L-valine 1676 replaced with L-aspartic acid (in Homo sapiens)
L-valine 1676 replaced with L-aspartic acid (in Homo sapiens)
L-valine 1676 replaced with L-aspartic acid (in Homo sapiens)
L-valine 1676 replaced with L-aspartic acid (in Homo sapiens)
L-valine 1676 replaced with L-aspartic acid (in Homo sapiens)
L-valine 1676 replaced with L-aspartic acid (in Homo sapiens)
L-valine 1676 replaced with L-aspartic acid (in Homo sapiens)
L-valine 1676 replaced with L-aspartic acid (in Homo sapiens)
L-valine 1676 replaced with L-aspartic acid (in Homo sapiens)
L-valine 1676 replaced with L-aspartic acid (in Homo sapiens)
L-valine 1676 replaced with L-aspartic acid (in Homo sapiens)
L-valine 177 replaced with glycine
L-valine 237 replaced with L-glutamic acid
L-valine 2476 replaced with L-proline
L-valine 2476 replaced with L-proline (in Homo sapiens)
L-valine 2476 replaced with L-proline (in Homo sapiens)
L-valine 2476 replaced with L-proline (in Homo sapiens)
L-valine 2476 replaced with L-proline (in Homo sapiens)
L-valine 2476 replaced with L-proline (in Homo sapiens)
L-valine 2476 replaced with L-proline (in Homo sapiens)
L-valine 2476 replaced with L-proline (in Homo sapiens)
L-valine 2476 replaced with L-proline (in Homo sapiens)
L-valine 2476 replaced with L-proline (in Homo sapiens)
L-valine 2476 replaced with L-proline (in Homo sapiens)
L-valine 2476 replaced with L-proline (in Homo sapiens)
L-valine 2476 replaced with L-proline (in Homo sapiens)
L-valine 2476 replaced with L-proline (in Homo sapiens)
L-valine 2476 replaced with L-proline (in Homo sapiens)
L-valine 2476 replaced with L-proline (in Homo sapiens)
L-valine 264 replaced with glycine
L-valine 266 replaced with L-cysteine
L-valine 272 replaced with L-cysteine
L-valine 274 replaced with L-cysteine
L-valine 356 replaced with L-glutamine
L-valine 356 replaced with L-glutamine (in Homo sapiens)
L-valine 356 replaced with L-glutamine (in Homo sapiens)
L-valine 356 replaced with L-glutamine (in Homo sapiens)
L-valine 356 replaced with L-glutamine (in Homo sapiens)
L-valine 356 replaced with L-glutamine (in Homo sapiens)
L-valine 356 replaced with L-glutamine (in Homo sapiens)
L-valine 356 replaced with L-glutamine (in Homo sapiens)
L-valine 356 replaced with L-glutamine (in Homo sapiens)
L-valine 356 replaced with L-glutamine (in Homo sapiens)
L-valine 356 replaced with L-glutamine (in Homo sapiens)
L-valine 356 replaced with L-glutamine (in Homo sapiens)
L-valine 356 replaced with L-glutamine (in Homo sapiens)
L-valine 356 replaced with L-glutamine (in Homo sapiens)
L-valine 356 replaced with L-glutamine (in Homo sapiens)
L-valine 356 replaced with L-glutamine (in Homo sapiens)
L-valine 356 replaced with L-glutamine (in Homo sapiens)
L-valine 356 replaced with L-glutamine (in Homo sapiens)
L-valine 386 replaced with L-alanine
L-valine 415 replaced with L-glutamic acid
L-valine 432 replaced with L-leucine
L-valine 49 replaced with unknown
L-valine 550 replaced with L-glutamic acid
L-valine 550 replaced with L-glutamic acid (in Homo sapiens)
L-valine 550 replaced with L-glutamic acid (in Homo sapiens)
L-valine 550 replaced with L-glutamic acid (in Homo sapiens)
L-valine 550 replaced with L-glutamic acid (in Homo sapiens)
L-valine 550 replaced with L-glutamic acid (in Homo sapiens)
L-valine 550 replaced with L-glutamic acid (in Homo sapiens)
L-valine 550 replaced with L-glutamic acid (in Homo sapiens)
L-valine 550 replaced with L-glutamic acid (in Homo sapiens)
L-valine 550 replaced with L-glutamic acid (in Homo sapiens)
L-valine 550 replaced with L-glutamic acid (in Homo sapiens)
L-valine 550 replaced with L-glutamic acid (in Homo sapiens)
L-valine 550 replaced with L-glutamic acid (in Homo sapiens)
L-valine 550 replaced with L-glutamic acid (in Homo sapiens)
L-valine 550 replaced with L-glutamic acid (in Homo sapiens)
L-valine 550 replaced with L-glutamic acid (in Homo sapiens)
L-valine 550 replaced with L-glutamic acid (in Homo sapiens)
L-valine 550 replaced with L-glutamic acid (in Homo sapiens)
L-valine 550 replaced with L-glutamic acid (in Homo sapiens)
L-valine 550 replaced with L-glutamic acid (in Homo sapiens)
L-valine 550 replaced with L-glutamic acid (in Homo sapiens)
L-valine 550 replaced with L-glutamic acid (in Homo sapiens)
L-valine 550 replaced with L-glutamic acid (in Homo sapiens)
L-valine 550 replaced with L-leucine
L-valine 550 replaced with L-methionine
L-valine 617 replaced with L-phenylalanine
L-valine 617 replaced with L-phenylalanine (in Homo sapiens)
L-valine 617 replaced with L-phenylalanine (in Homo sapiens)
L-valine 617 replaced with L-phenylalanine (in Homo sapiens)
L-valine 617 replaced with L-phenylalanine (in Homo sapiens)
L-valine 617 replaced with L-phenylalanine (in Homo sapiens)
L-valine 617 replaced with L-phenylalanine (in Homo sapiens)
L-valine 617 replaced with L-phenylalanine (in Homo sapiens)
L-valine 617 replaced with L-phenylalanine (in Homo sapiens)
L-valine 617 replaced with L-phenylalanine (in Homo sapiens)
L-valine 617 replaced with L-phenylalanine (in Homo sapiens)
L-valine 617 replaced with L-phenylalanine (in Homo sapiens)
L-valine 617 replaced with L-phenylalanine (in Homo sapiens)
L-valine 617 replaced with L-phenylalanine (in Homo sapiens)
L-valine 617 replaced with L-phenylalanine (in Homo sapiens)
L-valine 617 replaced with L-phenylalanine (in Homo sapiens)
L-valine 617 replaced with L-phenylalanine (in Homo sapiens)
L-valine 661 replaced with L-glutamic acid
L-valine 68 replaced with glycine
Replacement of residues 1309 to 1311 by DWN
Replacement of residues 133 to 134 by SG
Replacement of residues 138 to 155 by KKSQNLFCRYYFCGTSGY
Replacement of residues 1417 to 1417 by L
Replacement of residues 171 to 211 by SRQPPTTTTGTQASSQPSQSSCCLGAPWPESSLPFRKPEIP
Replacement of residues 181 to 184 by VRLR
Replacement of residues 187 to 300 by PPSMCLTRTHCASRRQHKRWPSSLGGIEVRITCCSTCCLEVPQIITQPWMSPETGPCWLVAAFLRGLTGKATMSAFLSIVHCQLRWIFQRKDQVHGNTSSCHLRWVSILSTERT
Replacement of residues 198 to 250 by ALGLTTPRTWGLTSARRCWPKPASVLKTSDPTLMFLFPSFLRIIPGQEGRGGF
Replacement of residues 21 to 38 by WGCCGWTPAGARCCYAAS
Replacement of residues 234 to 348 by HHFGIALPQLVPITGVCGRYLLLLCWHDLCRGGHLGTLQQDHATILHAPGVQLPLLTASAPAYHPLPSPPHTQTQYQDRQTGDELFQVQDQEPLFLGHLYFKGGREPPAGDSTPE
Replacement of residues 261 to 279 by VHCTRQSRTWFSPRLTRAR
Replacement of residues 27 to 48 by CEYDVFPRRSGKQLPWGRGCDL
Replacement of residues 277 to 350 by AWWWGLLWEGLHQGRPLSCICCPLGGQVSGESRALPESACPGFLCHWCGRAAVHFHLHLRNLSEDRARAAGCGA
Replacement of residues 284 to 411 by HHAGAEGVGCGAPLRRLLHHGQCQHLARPAATAASGGHRQDSGGAGGAGAGARVRLRARGRWGQRGAPARLRLRARPQPRGAGPSALRRLRGQGGAAPPAASVRGLPHRPAHLRARRLPDPQGLERDV
Replacement of residues 320 to 350 by TRCPTRSLGLCMSSPGTPKSRQHSTQRSQLP
Replacement of residues 33 to 67 by FLTWLPWEPTPGRRAWLTITRLNIMWLPCMSIHPS
Replacement of residues 330 to 417 by HLTKNQVEDSTSFASIPAMPTTTSLLPTCWALPGVQWLGPHDLVPSCHPRSQAWALGITASPELHIPGLQESSSAWQEPSTPMHKAGD
Replacement of residues 345 to 349 by KRQEK
Replacement of residues 347 to 372 by VDPWSPLTTVSQGFCVSLTRCTSQKQ
Replacement of residues 348 to 349 by GA
Replacement of residues 352 to 369 by LICFCLYYKQFSLIIFL
Replacement of residues 369 to 414 by HLCCCTTTMNGCMRLCSSVGWTYIHACCLPLPVCLPCPVTAEPWNS
Replacement of residues 42 to 50 by SCWPPAFTA
Replacement of residues 477 to 489 by LDCPQIRHPGHRQ
Replacement of residues 485 to 506 by SAFATYKVKAAASAHPLQMEAY
Replacement of residues 490 to 497 by RSLSPSQC
Replacement of residues 5 to 15 by AGSCCGCSSAH
Replacement of residues 72 to 75 by SPR
Replacement of residues 870 to 960 by PLHHAATGGCRLSVLQTCPGGRLPGGGGDGGPAGARQGPQLQRNQKPARQPVGPPCPGGSQPEGHPAGGGAHWAVRPGRGAGLHGPYSGKR
Replacement of residues 88 to 95 by INLNFILV
Replacement of residues 91 to 103 by KREPPRAADRNHC
UniProt:A1Z9D7
UniProt:A4II45
UniProt:B0JYL0
UniProt:B0S6E3
UniProt:B0S6V6
UniProt:B0S6V7
UniProt:B1WAU7
UniProt:B2RUG9
UniProt:B3DHM7
UniProt:B3DKP7
UniProt:B3Y9G0
UniProt:B5RIT7
UniProt:C7FDX9
UniProt:D3ZP81
UniProt:D4A8X6
UniProt:D4AA78
UniProt:E1BNT4
UniProt:E1BQX5
UniProt:E1BYU0
UniProt:E1BZS9
UniProt:E1C8M4
UniProt:E1C9J6
UniProt:E2QXK1
UniProt:E2R4Y4
UniProt:E2R9W3
UniProt:E2RB53
UniProt:E9Q4H1
UniProt:E9QC17
UniProt:E9QFQ3
UniProt:E9QLQ9
UniProt:F1LNG1
UniProt:F1LNG5
UniProt:F1MAD0
UniProt:F1MUJ1
UniProt:F1MV51
UniProt:F1N1K8
UniProt:F1N7F3
UniProt:F1NEB1
UniProt:F1NGT2
UniProt:F1NPL8
UniProt:F1PAY5
UniProt:F1PF03
UniProt:F1PR91
UniProt:F1PXA0
UniProt:F1Q1X1
UniProt:F1Q1X7
UniProt:F1Q2Q9
UniProt:F1Q7T6
UniProt:F1QC44
UniProt:F1QED2
UniProt:F1QLQ0
UniProt:F1QN37
UniProt:F1QQ20
UniProt:F1QR49
UniProt:F1QTJ4
UniProt:F1RC81
UniProt:F1RLG3
UniProt:F1SKR9
UniProt:F1SPD2
UniProt:F6TM07
UniProt:F6UFM4
UniProt:F6UJ42
UniProt:F6V2S7
UniProt:F6XK08
UniProt:F6Z0J4
UniProt:F7ACT4
UniProt:F7BDU6
UniProt:F7BVL1
UniProt:F7CQU7
UniProt:F8W4Z3
UniProt:G3MX34
UniProt:G3N0T7
UniProt:G3N1T2
UniProt:G3V6K6
UniProt:G3V8Q9
UniProt:G5EDP9
UniProt:H0YRX9
UniProt:H0YU95
UniProt:H0YXT8
UniProt:H0YYN0
UniProt:H0ZI60
UniProt:H0ZKM3
UniProt:H0ZT29
UniProt:H1A1J4
UniProt:H9GZ46
UniProt:I3LFU7
UniProt:I3LLB7
UniProt:I3LMY0
UniProt:I6YP72
UniProt:I6ZX61
UniProt:J9NXS9
UniProt:J9P2V1
UniProt:J9P4S5
UniProt:K7GMM8
UniProt:K7GMW5
UniProt:K7GQE9
UniProt:K7GQI5
UniProt:K7GS16
UniProt:K7GSS4
UniProt:K7GSV4
UniProt:K7GSZ3
UniProt:M0R9M6
UniProt:M0RC47
UniProt:O46680
UniProt:O55168
UniProt:O61458
UniProt:O62609
UniProt:O76259
UniProt:O77069
UniProt:P04412
UniProt:P13387
UniProt:P18266 Gsk3b
UniProt:P18431
UniProt:P23727
UniProt:P24348
UniProt:P26450 Pik3r1
UniProt:P80204
UniProt:P83101
UniProt:P91667
UniProt:P91943
UniProt:P97471 Smad4
UniProt:Q01279
UniProt:Q10666
UniProt:Q19ML3
UniProt:Q19ML6
UniProt:Q19ML7
UniProt:Q1MW21
UniProt:Q21227
UniProt:Q28E60
UniProt:Q3UQT2
UniProt:Q5NCP0
UniProt:Q64729
UniProt:Q6AWJ8
UniProt:Q6JDJ5
UniProt:Q6QT04
UniProt:Q702V6
UniProt:Q702V7
UniProt:Q7KPL1
UniProt:Q864U2
UniProt:Q864U3
UniProt:Q8BNP7
UniProt:Q8C493
UniProt:Q8C9I9
UniProt:Q8HY60
UniProt:Q8IMA8
UniProt:Q8IMG6
UniProt:Q91VN0
UniProt:Q924A0
UniProt:Q95V09
UniProt:Q961B0
UniProt:Q9GKQ9
UniProt:Q9JLR6
UniProt:Q9NHE9
UniProt:Q9U010
UniProt:Q9U2Q9
UniProt:Q9VAS9
UniProt:Q9W7B9
UniProt:Q9WTS1
UniProt:Q9WV60 Gsk3b
UniProt:Q9Y1T2
UniProt:Q9YH60
UniProt:U3JA54
UniProt:U3JAK3
UniProt:V5LVG2