ERLIN2(1-185):p-8Y FGFR1(c.-88-822) fusion [plasma membrane]

Stable Identifier
R-HSA-8853122
Type
Protein [EntityWithAccessionedSequence]
Species
Homo sapiens
Compartment
Locations in the PathwayBrowser
Literature References
PubMed ID Title Journal Year
23558953 Identification of targetable FGFR gene fusions in diverse cancers

Wu, YM, Su, F, Kalyana-Sundaram, S, Khazanov, N, Ateeq, B, Cao, X, Lonigro, RJ, Vats, P, Wang, R, Lin, SF, Cheng, AJ, Kunju, LP, Siddiqui, J, Tomlins, SA, Wyngaard, P, Sadis, S, Roychowdhury, S, Hussain, MH, Feng, FY, Zalupski, MM, Talpaz, M, Pienta, KJ, Rhodes, DR, Robinson, DR, Chinnaiyan, AM

Cancer Discov 2013
External Reference Information
External Reference
Gene Names
ERLIN2, C8orf2, SPFH2, UNQ2441/PRO5003/PRO9924
Chain
chain:1-339
Other Identifiers
11160
11731043_s_at
11731044_at
11731045_s_at
11735259_a_at
11735260_s_at
11741586_a_at
11741587_x_at
11745025_a_at
11745026_a_at
11759837_at
17067902
221542_s_at
221543_s_at
238615_at
3094237
3094244
3094246
3094247
3094248
3094249
3094250
3094251
3094252
3094253
3094254
3094255
3094256
3094257
3094258
3094259
3094260
3094261
3094262
3094263
3094264
3094265
3094266
3094267
3094269
3094273
3094281
3094283
3094285
3094287
3094288
3094289
37798_at
49388_at
79608_at
8145835
83018_at
A_23_P123440
A_24_P21266
A_24_P372217
A_24_P765540
A_33_P3363061
GE81734
GO:0003674
GO:0005515
GO:0005575
GO:0005622
GO:0005737
GO:0005783
GO:0005789
GO:0005829
GO:0005886
GO:0006629
GO:0006810
GO:0006950
GO:0007165
GO:0008150
GO:0008202
GO:0008203
GO:0008289
GO:0009056
GO:0009058
GO:0015485
GO:0016020
GO:0016021
GO:0019899
GO:0030433
GO:0031625
GO:0032933
GO:0032991
GO:0034641
GO:0043226
GO:0044281
GO:0045121
GO:0045541
GO:0045717
GO:0055085
Hs.125849.0.S2_3p_a_at
Hs.143848.0.A1_3p_at
ILMN_1700549
PH_hs_0031629
TC08000277.hg
g10241715_3p_a_at
Participant Of
Other forms of this molecule
Modified Residues
Name
Replacement of residues 185 to 185 by LVSLKRRIELTVEYPWRCGALSPTSNCRTG
Name
Insertion of residues 1 to 822 at 214 from UniProt:P11362 FGFR1
Coordinate
214
Name
O4'-phospho-L-tyrosine at 463
Coordinate
463
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
Name
O4'-phospho-L-tyrosine at 583
Coordinate
583
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
Name
O4'-phospho-L-tyrosine at 585
Coordinate
585
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
Name
O4'-phospho-L-tyrosine at 653
Coordinate
653
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
Name
O4'-phospho-L-tyrosine at 654
Coordinate
654
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
Name
O4'-phospho-L-tyrosine at 730
Coordinate
730
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
Name
O4'-phospho-L-tyrosine at 766
Coordinate
766
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
Name
O4'-phospho-L-tyrosine at 776
Coordinate
776
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
Disease
Name Identifier Synonyms
breast cancer 1612 malignant tumor of the breast, mammary cancer, malignant neoplasm of breast, mammary tumor, primary breast cancer, breast cancer, Ca breast - NOS, breast tumor
Cite Us!