RB1 R73Sfs*36 [cytosol]

Stable Identifier
Protein [EntityWithAccessionedSequence]
Homo sapiens
RB1 R73Sfs*36 [cytosol] icon
Locations in the PathwayBrowser
External Reference Information
External Reference
Gene Names
initiator methionine:1, chain:2-928
Reference Transcript
Other Identifiers
Participant Of
Other forms of this molecule
Modified Residues
Replacement of residues 73 to 108 by SLVNLGESFICGWSIGRLYSKEKGTVGNLYLYCSS
Name Identifier Synonyms
cancer 162 malignant tumor, malignant neoplasm, primary cancer
colon adenocarcinoma 234 adenocarcinoma of the colon, adenocarcinoma of colon, Colonic adenocarcinoma
breast cancer 1612 malignant tumor of the breast, mammary cancer, malignant neoplasm of breast, mammary tumor, primary breast cancer, breast cancer, Ca breast - NOS, breast tumor
prostate cancer 10283 NGP - New growth of prostate, neoplasm of prostate (disorder), tumor of the prostate, malignant tumor of prostate (disorder), prostate neoplasm, malignant tumor of the prostate, malignant tumor of prostate (disorder), prostatic cancer, prostatic neoplasm
lung squamous cell carcinoma 3907 squamous cell carcinoma of lung (disorder), Epidermoid cell carcinoma of the lung
Cross References
ZINC - Substances
ZINC target
ZINC - Predictions - Purchasable
Interactors (59)
Accession #Entities Entities Confidence Score Evidence (IntAct)
 UniProt:P03129 VE7      0.967 27
 UniProt:Q01094 E2F1  2 0.963 24
 UniProt:Q13547 HDAC1  2 0.956 18
 UniProt:P03070 LT      0.927 9
 UniProt:P03255 E1A      0.921 10
 UniProt:Q14209 E2F2  1 0.78 5
 UniProt:P62136 PPP1CA  1 0.771 5
 UniProt:O00716 E2F3  2 0.77 4
 UniProt:Q00987 MDM2  11 0.734 5
 UniProt:P04020 VE7      0.702 3
 UniProt:P03255-2      0.702 3
 UniProt:P06788 VE7      0.702 3
 UniProt:P06464 VE7      0.688 3
 UniProt:Q14186 TFDP1  1 0.669 5
 UniProt:P06400 RB1  394 0.667 3
 UniProt:P52927  1 0.632 5
 UniProt:P24941 CDK2  5 0.623 3
 UniProt:Q16539 MAPK14  7 0.623 4
 UniProt:P24385 CCND1  4 0.623 2
 UniProt:P30285 Cdk4  6 0.623 2
 UniProt:P39880 CUX1  2 0.611 4
 UniProt:P62993 GRB2  1 0.61 4
 UniProt:Q15329 E2F5  1 0.609 2
 UniProt:O96017 CHEK2  3 0.602 3
 UniProt:Q923E4 Sirt1  2 0.602 4
 UniProt:Q14686 NCOA6  1 0.593 3
 UniProt:Q96PU4 UHRF2  1 0.591 4
 UniProt:Q13574-2 DGKZ      0.591 6
 UniProt:P03255-1      0.589 2
 UniProt:Q3TKT4  1 0.573 4
 UniProt:Q93009 USP7  2 0.571 8
 UniProt:Q9Y463 DYR1B      0.567 3
 UniProt:Q13627 DYRK1A  1 0.567 3
 UniProt:Q14188 TFDP2  1 0.564 2
 UniProt:Q99708 RBBP8  4 0.564 2
 UniProt:P03254 E1A      0.558 3
 UniProt:O14757 CHEK1  3 0.558 3
 UniProt:P0C6X7-PRO_0000037321 REP      0.556 3
 UniProt:Q8VSP9 OSPF      0.544 2
 IntAct:EBI-971875 DGKZ-MARCKS-PSD      0.544 2
 UniProt:P55345 ANM2      0.544 3
 UniProt:P42685 FRK  4 0.544 3
 UniProt:Q9R002 IFI2      0.544 5
 UniProt:P06465 VE7      0.525 2
 UniProt:Q9Y676 MRPS18B  1 0.525 2
 UniProt:Q16254 E2F4  1 0.524 3
 UniProt:O15151 MDM4  5 0.524 4
 UniProt:P24863 CCNC  1 0.524 4
 UniProt:Q86500-PRO_0000041225      0.524 3
 UniProt:A0MPS7 A0MPS7      0.524 2
 UniProt:P07197 NFM      0.524 2
 UniProt:Q9UQ80 PA2G4  2 0.524 4
 UniProt:Q00577 PURA      0.524 6
 UniProt:O75150 RNF40  1 0.508 3
 UniProt:Q9UKV8 AGO2  2 0.499 3
 UniProt:P29375 KDM5A  1 0.499 2
 UniProt:O43524 FOXO3  9 0.499 2
 UniProt:Q14653 IRF3  4 0.499 2
 UniProt:Q5R372-2 RABGAP1L      0.488 2
Cite Us!