BRCA1 F869Vfs*35 [nucleoplasm]

Stable Identifier
Protein [EntityWithAccessionedSequence]
Homo sapiens
BRCA1 Phe869Valfs*35, BRCA1 F869VfsTER35, BRCA1 Phe869ValfsTER35
BRCA1 F869Vfs*35 [nucleoplasm] icon
Locations in the PathwayBrowser
External Reference Information
External Reference
Gene Names
Other Identifiers
Other forms of this molecule
Modified Residues
Replacement of residues 869 to 902 by VICSVFKSRKCRRGMCNILCPLWVLKETKSKSHF
Name Identifier Synonyms
cancer DOID:162 malignant tumor, malignant neoplasm, primary cancer
ovarian carcinoma DOID:4001 Ovarian carcinoma
Interactors (44)
Accession #Entities Entities Confidence Score Evidence (IntAct)
 UniProt:Q9BX63 BRIP1  2 0.976 28
 UniProt:Q99728 BARD1  13 0.951 17
 UniProt:Q86YC2 PALB2  20 0.909 27
 UniProt:Q99708 RBBP8  4 0.907 12
 UniProt:Q6UWZ7 ABRAXAS1  1 0.818 15
 UniProt:P03372 ESR1  8 0.811 16
 UniProt:O15360 FANCA  1 0.747 5
 UniProt:P51587 BRCA2  20 0.727 8
 UniProt:Q06609 RAD51  2 0.718 6
 UniProt:Q96RL1 UIMC1  1 0.717 10
 UniProt:Q14192 FHL2  1 0.715 6
 UniProt:P16104 H2AX  7 0.714 4
 UniProt:Q12888 TP53BP1  3 0.7 5
 UniProt:P27694 RPA1  2 0.65 3
 UniProt:Q14676 MDC1  6 0.629 4
 UniProt:P78347 GTF2I      0.61 5
 UniProt:Q6PJG6 BRAT1      0.602 6
 UniProt:Q8WX92 NELFB  3 0.602 5
 UniProt:P63165 SUMO1  11 0.602 3
 UniProt:Q61188 Ezh2  1 0.591 5
 UniProt:P61956 SUMO2  5 0.589 2
 UniProt:Q9BXW9 FANCD2  3 0.583 3
 UniProt:Q9GZX5 ZNF350  1 0.581 3
 UniProt:P62140 PPP1CB  4 0.581 3
 UniProt:Q16666 IFI16  1 0.556 9
 UniProt:P03126 VE6      0.544 7
 UniProt:P03129 VE7      0.544 5
 UniProt:P04637 TP53  20 0.544 2
 UniProt:Q92560 BAP1  1 0.543 3
 UniProt:P38398 BRCA1  20 0.536 2
 UniProt:P36873 PPP1CC  1 0.524 2
 UniProt:Q6NZY4 ZCHC8      0.524 2
 UniProt:P62136 PPP1CA  1 0.524 2
 UniProt:P11388 TOP2A  3 0.524 3
 UniProt:Q13085 ACACA  2 0.524 2
 UniProt:P52292 KPNA2  2 0.508 3
 UniProt:Q7Z569 BRAP  2 0.508 3
 UniProt:P10809 HSPD1  6 0.508 2
 UniProt:O75330 HMMR  2 0.499 4
 UniProt:P46736 BRCC3  2 0.483 2
 UniProt:Q9ULW0 TPX2  2 0.483 4
 UniProt:P40692 MLH1  3 0.483 2
 UniProt:O14757 CHEK1  3 0.463 3
 UniProt:P24385 CCND1  4 0.463 3
Cite Us!