PALB2 F816Sfs*35 [nucleoplasm]

Stable Identifier
Protein [EntityWithAccessionedSequence]
Homo sapiens
Locations in the PathwayBrowser
External Reference Information
External Reference
Gene Names
Reference Transcript
Other Identifiers
Other forms of this molecule
Modified Residues
Replacement of residues 816 to 849 by SLLKKISSVETHARSCINIPSNRLKQQSFLLLIA
Name Identifier Synonyms
cancer DOID:162 malignant tumor, malignant neoplasm, primary cancer
bile duct adenocarcinoma DOID:4896
Cross References
Pharos - Targets
Interactors (11)
Accession #Entities Entities Confidence Score Evidence (IntAct)
 UniProt:P51587 BRCA2  20 0.969 25
 UniProt:P38398 BRCA1  20 0.909 27
 UniProt:Q06609 RAD51  2 0.8 8
 UniProt:Q9UBU8-2 MORF4L1      0.713 3
 UniProt:Q9Y253 POLH  2 0.672 7
 UniProt:Q14145 KEAP1  3 0.666 4
 UniProt:O43502 RAD51C  1 0.612 10
 UniProt:O43542 XRCC3  1 0.577 3
 IntAct:EBI-4399559 UBIQ      0.544 2
 UniProt:Q9UBU8 MORF4L1  1 0.527 2
 UniProt:P51784 USP11  1 0.499 2
Cite Us!