BRCA2 D2983Ffs*34 [cytosol]

Stable Identifier
Protein [EntityWithAccessionedSequence]
Homo sapiens
BRCA2 Asp2983Phefs*34, BRCA2 D2983FfsTER34, BRCA2 Asp2983PhefsTER34
Locations in the PathwayBrowser
Literature References
PubMed ID Title Journal Year
28058502 A novel loss-of-function heterozygous BRCA2 c.8946_8947delAG mutation found in a Chinese woman with family history of breast cancer

Xiong, L, Jian, W, Xiao, D, Wang, X, Ma, D, Ma, J, Yang, J, Xia, W

J Cancer Res Clin Oncol 2017
External Reference Information
External Reference
Gene Names
Reference Transcript
Other Identifiers
Other forms of this molecule
Modified Residues
Replacement of residues 2983 to 3015 by FSYTEYLASIIRFIFSVNRRKEIQNLSSCNFKI
Name Identifier Synonyms
cancer DOID:162 malignant tumor, malignant neoplasm, primary cancer
breast cancer DOID:1612 malignant tumor of the breast, mammary cancer, malignant neoplasm of breast, mammary tumor, primary breast cancer, breast cancer, Ca breast - NOS, breast tumor
Cross References
Pharos - Targets
Interactors (18)
Accession #Entities Entities Confidence Score Evidence (IntAct)
 UniProt:Q06609 RAD51  2 0.982 46
 UniProt:Q86YC2 PALB2  20 0.969 25
 UniProt:P60896 SEM1  2 0.83 10
 UniProt:Q14565 DMC1  1 0.765 12
 UniProt:Q06609-1 RAD51      0.743 12
 UniProt:P38398 BRCA1  20 0.727 8
 UniProt:Q9BXW9 FANCD2  3 0.688 16
 UniProt:Q9Y253 POLH  2 0.676 6
 UniProt:P04637 TP53  20 0.655 7
 UniProt:Q9NTI5 PDS5B  4 0.641 26
 UniProt:Q9P0W2 HMG20B  1 0.576 8
 UniProt:P51587 BRCA2  20 0.573 3
 UniProt:O43502 RAD51C  1 0.532 5
 UniProt:Q9UJY1 HSPB8  1 0.527 2
 UniProt:O43542 XRCC3  1 0.527 2
 UniProt:Q8IZU3 SYCP3  1 0.463 2
 UniProt:P15927 RPA2  2 0.462 3
 UniProt:P27694 RPA1  2 0.462 3
Cite Us!