ERLIN2(1-185):FGFR1(c.-88-822) fusion [plasma membrane]

Stable Identifier
Protein [EntityWithAccessionedSequence]
Homo sapiens
Locations in the PathwayBrowser
Literature References
PubMed ID Title Journal Year
23558953 Identification of targetable FGFR gene fusions in diverse cancers

Kalyana-Sundaram, S, Chinnaiyan, AM, Wang, R, Tomlins, SA, Ateeq, B, Cao, X, Cheng, AJ, Rhodes, DR, Hussain, MH, Kunju, LP, Lonigro, RJ, Robinson, DR, Sadis, S, Talpaz, M, Lin, SF, Pienta, KJ, Feng, FY, Roychowdhury, S, Vats, P, Wu, YM, Wyngaard, P, Su, F, Khazanov, N, Siddiqui, J, Zalupski, MM

Cancer Discov 2013
External Reference Information
External Reference
Gene Names
ERLIN2, C8orf2, SPFH2, UNQ2441/PRO5003/PRO9924
Other Identifiers
Other forms of this molecule
Modified Residues
Replacement of residues 185 to 185 by LVSLKRRIELTVEYPWRCGALSPTSNCRTG
Insertion of residues 1 to 822 at 214 from UniProt:P11362 FGFR1
Name Identifier Synonyms
breast cancer DOID:1612 malignant tumor of the breast, mammary cancer, malignant neoplasm of breast, mammary tumor, primary breast cancer, breast cancer, Ca breast - NOS, breast tumor
Cite Us!