DAXX H26Tfs*118 [nucleoplasm]

Stable Identifier
R-HSA-9673114
Type
Protein [EntityWithAccessionedSequence]
Species
Homo sapiens
Compartment
Locations in the PathwayBrowser
External Reference Information
External Reference
Gene Names
DAXX, BING2, DAP6
Chain
chain:1-740
Other Identifiers
0002320093
113523636
11719376_a_at
11738202_x_at
11747723_a_at
1616
17018240
17030053
17032737
17037538
17040248
1754_at
201763_s_at
2950669
2950670
2950673
2950674
2950676
2950677
2950679
2950680
2950682
2950683
2950684
41161_at
8125734
8178991
8180179
AF006041_at
A_23_P122579
GE62725
GO:0000775
GO:0001934
GO:0002039
GO:0003674
GO:0003713
GO:0003714
GO:0005515
GO:0005575
GO:0005622
GO:0005634
GO:0005654
GO:0005694
GO:0005730
GO:0005737
GO:0005829
GO:0006259
GO:0006325
GO:0006334
GO:0006338
GO:0006355
GO:0006464
GO:0006915
GO:0006950
GO:0007165
GO:0007257
GO:0008134
GO:0008150
GO:0008219
GO:0008625
GO:0009058
GO:0016032
GO:0016604
GO:0016605
GO:0019058
GO:0019899
GO:0019901
GO:0022607
GO:0030234
GO:0030295
GO:0030521
GO:0031072
GO:0031396
GO:0031625
GO:0034605
GO:0034620
GO:0034641
GO:0042393
GO:0042803
GO:0042981
GO:0043226
GO:0044403
GO:0045860
GO:0045892
GO:0045893
GO:0047485
GO:0048239
GO:0050681
GO:0051276
GO:0065003
GO:0071276
GO:0071280
GO:0072738
GO:0140037
GO:0140416
GO:1900051
GO:1901216
GO:1901796
GO:1903936
HMNXSV003049075
Hs.180224.2.S1_3p_s_at
ILMN_1708077
PH_hs_0032729
TC06001586.hg
TC06003607.hg
TC6_cox_hap2000210.hg
TC6_dbb_hap3000196.hg
TC6_mcf_hap5000185.hg
TC6_qbl_hap6000198.hg
g4503256_3p_s_at
Participates
Other forms of this molecule
Modified Residues
Name
Replacement of residues 26 to 142 by THSPMRPHLGQKPLAPLSLMGPEEAVVRAARNATSWRMRSCSKSSLNFVRCRQQTTLRWSHSSITGSNVPTLCFWPRRSSATSSLGSCLGPGAGQPSSMSTSMSSALFSRPTQPKRS
Disease
Name Identifier Synonyms
oral cavity cancer DOID:8618 malignant tumor of lateral floor of mouth (disorder), malignant tumor of anterior floor of mouth (disorder), malignant neoplasm of other sites of floor of mouth, malignant tumor of floor of mouth (disorder), malignant neoplasm of anterior portion of floor of mouth, malignant neoplasm of lateral floor of mouth, malignant neoplasm of floor of mouth, NOS, malignant neoplasm of other sites of floor of mouth (disorder), malignant neoplasm of floor of mouth NOS (disorder), malignant neoplasm of floor of mouth, oral cavity cancer, malignant tumor of the Floor of the Mouth, malignant neoplasm of lateral portion of floor of mouth, malignant neoplasm of floor of mouth
cancer DOID:162 malignant tumor, malignant neoplasm, primary cancer
Interactors (81)
Accession #Entities Entities Confidence Score Evidence (IntAct)
 UniProt:Q00987 MDM2  11 0.895 18
 UniProt:P46100 ATRX  138 0.848 8
 UniProt:P04637 TP53  1328 0.84 12
 UniProt:Q99683 MAP3K5  1 0.806 7
 UniProt:P84243 H3-3A  15 0.806 6
 UniProt:Q93009 USP7  2 0.799 14
 UniProt:Q08379 GOLGA2  3 0.795 8
 UniProt:Q96EZ8 MCRS1  1 0.793 11
 UniProt:P29590 PML  5 0.791 6
 UniProt:P63165 SUMO1  155 0.783 7
 UniProt:Q7Z6G3-2 NECAB2      0.718 6
 UniProt:Q99497 PARK7  7 0.714 6
 UniProt:Q8ND90 PNMA1      0.696 5
 UniProt:P03179 MTP      0.693 5
 UniProt:P02794 FTH1  5 0.691 5
 UniProt:O43791 SPOP  1 0.69 5
 UniProt:P25445 FAS  1 0.674 3
 UniProt:P62805 H4C1  19 0.669 4
 UniProt:Q8IZU0 FAM9B      0.666 4
 UniProt:P63279 UBE2I  8 0.647 3
 UniProt:P25446  1 0.635 4
 UniProt:Q9NS23 RASF1      0.628 6
 UniProt:P10275 AR  4 0.625 5
 UniProt:P14672 SLC2A4  2 0.625 7
 UniProt:Q9NS23-4 RASSF1      0.618 5
 UniProt:P04792 HSPB1  3 0.618 4
 UniProt:Q8N726 CDKN2A  12 0.611 8
 UniProt:P15991 HSPB1      0.581 3
 UniProt:Q02650  1 0.581 4
 UniProt:P0CG48 UBC  325