CLTC(2-1634)-p-7Y ALK(1058-1620) fusion [cytosol]

Stable Identifier
Protein [EntityWithAccessionedSequence]
Homo sapiens
fullName evidence="36 37"Clathrin heavy chain 1, CLH1_HUMAN
Locations in the PathwayBrowser
Literature References
PubMed ID Title Journal Year
12750159 ALK activation by the CLTC-ALK fusion is a recurrent event in large B-cell lymphoma

De Paepe, P, Baens, M, van Krieken, H, Verhasselt, B, Stul, M, Simons, A, Poppe, B, Laureys, G, Brons, P, Vandenberghe, P, Speleman, F, Praet, M, De Wolf-Peeters, C, Marynen, P, Wlodarska, I

Blood 2003
External Reference Information
External Reference
Gene Names
initiator methionine:1, chain:2-1675
Reference Transcript
Other Identifiers
Other forms of this molecule
Modified Residues
Insertion of residues 1058 to 1620 at 1635 from UniProt:Q9UM73 ALK
Replacement of residues 1634 to 1634 by YDGVSSVTQAGVQWRDLGSLQPSRARLPGHVAADHPPA
O4'-phospho-L-tyrosine at 1278
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
O4'-phospho-L-tyrosine at 1282
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
O4'-phospho-L-tyrosine at 1283
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
O4'-phospho-L-tyrosine at 1096
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
O4'-phospho-L-tyrosine at 1358
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
O4'-phospho-L-tyrosine at 1507
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
O4'-phospho-L-tyrosine at 1604
PsiMod Name
PsiMod Definition
A protein modification that effectively converts an L-tyrosine residue to O4'-phospho-L-tyrosine.
Cross References
ZINC - Substances
ZINC target
Pharos - Targets
ZINC - Predictions - Purchasable
HMDB Protein
Interactors (8)
Accession #Entities Entities Confidence Score Evidence (IntAct)
 UniProt:Q14164 IKBKE  4 0.589 2
 UniProt:O14920 IKBKB  3 0.536 2
 UniProt:P10242 MYB  1 0.499 4
 UniProt:P49407 ARRB1  5 0.491 3
 1-phosphatidyl-1D-myo-inositol 3,5-bisphosphate [ChEBI:16851]  7 0.462 2
 UniProt:P03372 ESR1  8 0.462 2
 1-phosphatidyl-1D-myo-inositol 3,4,5-trisphosphate [ChEBI:16618]  6 0.462 2
 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate [ChEBI:18348]  6 0.462 2
Cite Us!