ITM2B(244-266) [extracellular region]

Stable Identifier
Protein [EntityWithAccessionedSequence]
Homo sapiens
ABri/ADan amyloid peptide, Integral membrane protein 2B, ITM2B_HUMAN, ITM2B
Locations in the PathwayBrowser

The ABri and ADan peptides are extensions of the normal C terminus of ITM2B (BRI). The sequence of ABri results from mutatin of the normal stop codon to R, resulting in an additional 11 residues. The ABri peptide is the last 34 residues of this mutated peptide - EASNCFAIRHFENKFAVETLICSRTVKKNIIEEN. The ADan peptide is the result of a 10 nucleotide insertion between the codons for residue 265 and 266, introducing a frameshift that adds a different extension to the normal peptide. The ADan peptide is the last 34 residues of this mutated peptide, identical to ABri for the first 22 residues. EASNCFAIRHFENKFAVETLICFNLFLNSQEKHY

External Reference Information
External Reference
Gene Names
chain:1-266, chain:1-243, chain:1-, chain:-243, peptide:244-266
Reference Transcript
Other Identifiers
Cross References
Pharos - Targets
Interactors (5)
Accession #Entities Entities Confidence Score Evidence (IntAct)
 UniProt:P05067 APP  20 0.675 4
 UniProt:P26715 KLRC1  1 0.556 3
 UniProt:P56817 BACE1  8 0.556 4
 UniProt:O43889 CREB3  7 0.553 2
 UniProt:P04578 env  7 0.462 3
Cite Us!