RB1 P777Lfs*33 [cytosol]

Stable Identifier
Protein [EntityWithAccessionedSequence]
Homo sapiens
RB1 P777Lfs*33 [cytosol] icon
Locations in the PathwayBrowser
External Reference Information
External Reference
Gene Names
initiator methionine:1, chain:2-928
Reference Transcript
Other Identifiers
Other forms of this molecule
Modified Residues
Replacement of residues 777 to 808 by LPCHQYLTFLEALTSFLVHPYGFLEGTSIFHP
Name Identifier Synonyms
prostate adenocarcinoma DOID:2526 adenocarcinoma of prostate (disorder), prostate adenocarcinoma
cancer DOID:162 malignant tumor, malignant neoplasm, primary cancer
lung squamous cell carcinoma DOID:3907 squamous cell carcinoma of lung (disorder), Epidermoid cell carcinoma of the lung
lung small cell carcinoma DOID:5409
stomach cancer DOID:10534 malignant neoplasm of greater curvature of stomach, unspecified, malignant neoplasm of lesser curvature of stomach, NOS, malignant tumor of body of stomach (disorder), neoplasm of stomach (disorder), Ca lesser curvature - stomach (disorder), malignant neoplasm of greater curve of stomach unspecified (disorder), Ca body - stomach, ca lesser curvature of stomach, ca greater curvature of stomach, malignant neoplasm of lesser curvature of stomach, unspecified, malignant tumor of lesser curve of stomach (disorder), malignant neoplasm of body of stomach, gastric neoplasm, malignant neoplasm of greater curvature of stomach, NOS, Ca body - stomach (disorder), stomach neoplasm, Ca greater curvature - stomach (disorder), malignant neoplasm of lesser curve of stomach unspecified (disorder), malignant tumor of greater curve of stomach (disorder)
breast cancer DOID:1612 malignant tumor of the breast, mammary cancer, malignant neoplasm of breast, mammary tumor, primary breast cancer, breast cancer, Ca breast - NOS, breast tumor
Cross References
ZINC - Substances
ZINC target
Pharos - Targets
ZINC - Predictions - Purchasable
Interactors (59)
Accession #Entities Entities Confidence Score Evidence (IntAct)
 UniProt:P03129 VE7      0.969 28
 UniProt:Q01094 E2F1  2 0.963 24
 UniProt:Q13547 HDAC1  2 0.955 18
 UniProt:P03070 LT      0.927 9
 UniProt:P03255 E1A      0.921 10
 UniProt:Q14209 E2F2  1 0.78 5
 UniProt:P06788 VE7      0.772 4
 UniProt:P62136 PPP1CA  1 0.771 5
 UniProt:O00716 E2F3  2 0.77 4
 UniProt:Q00987 MDM2  11 0.734 5
 UniProt:P24385 CCND1  4 0.73 5
 UniProt:P04020 VE7      0.702 3
 UniProt:P03255-2      0.702 3
 UniProt:P06464 VE7      0.688 3
 UniProt:Q14186 TFDP1  1 0.669 5
 UniProt:P06400 RB1  20 0.667 3
 UniProt:P06465 VE7      0.647 3
 UniProt:P52927  1 0.632 5
 UniProt:P24941 CDK2  5 0.623 3
 UniProt:P30285 Cdk4  6 0.623 2
 UniProt:Q16539 MAPK14  7 0.623 4
 UniProt:P39880 CUX1  2 0.611 4
 UniProt:P62993 GRB2  1 0.61 4
 UniProt:Q15329 E2F5  1 0.609 2
 UniProt:Q923E4 Sirt1  2 0.602 4
 UniProt:O96017 CHEK2  3 0.602 3
 UniProt:Q14686 NCOA6  1 0.593 3
 UniProt:Q96PU4 UHRF2  1 0.591 4
 UniProt:Q13574-2 DGKZ      0.591 6
 UniProt:P03255-1      0.589 2
 UniProt:Q3TKT4  1 0.573 4
 UniProt:Q93009 USP7  2 0.571 8
 UniProt:Q9Y463 DYR1B      0.567 3
 UniProt:Q13627 DYRK1A  1 0.567 3
 UniProt:Q99708 RBBP8  4 0.564 2
 UniProt:Q14188 TFDP2  1 0.564 2
 UniProt:P03254 E1A      0.558 3
 UniProt:O14757 CHEK1  3 0.558 3
 UniProt:P0C6X7-PRO_0000037321 REP      0.556 3
 UniProt:Q8VSP9 OSPF      0.544 2
 IntAct:EBI-971875 DGKZ-MARCKS-PSD      0.544 2
 UniProt:P55345 ANM2      0.544 3
 UniProt:Q9R002 IFI2      0.544 5
 UniProt:P42685 FRK  4 0.544 3
 UniProt:Q9Y676 MRPS18B  1 0.525 2
 UniProt:Q16254 E2F4  1 0.524 3
 UniProt:O15151 MDM4  5 0.524 4
 UniProt:Q86500-PRO_0000041225      0.524 3
 UniProt:A0MPS7 A0MPS7      0.524 2
 UniProt:P07197 NFM      0.524 2
 UniProt:Q9UQ80 PA2G4  2 0.524 4
 UniProt:Q00577 PURA      0.524 6
 UniProt:P24863 CCNC  1 0.524 4
 UniProt:O75150 RNF40  1 0.508 3
 UniProt:Q9UKV8 AGO2  2 0.499 3
 UniProt:P29375 KDM5A  1 0.499 2
 UniProt:Q14653 IRF3  4 0.499 2
 UniProt:O43524 FOXO3  9 0.499 2
 UniProt:Q5R372-2 RABGAP1L      0.488 2
Cite Us!