RB1 R775Gfs*35 [cytosol]

Stable Identifier
Protein [EntityWithAccessionedSequence]
Homo sapiens
RB1 R775Gfs*35 [cytosol] icon
Locations in the PathwayBrowser
External Reference Information
External Reference
Gene Names
initiator methionine:1, chain:2-928
Reference Transcript
Other Identifiers
Other forms of this molecule
Modified Residues
Replacement of residues 775 to 808 by GPLPCHQYLTFLEALTSFLVHPYGFLEGTSIFHP
Name Identifier Synonyms
lung small cell carcinoma DOID:5409
cancer DOID:162 malignant tumor, malignant neoplasm, primary cancer
Cross References
ZINC - Substances
ZINC target
ZINC - Predictions - Purchasable
Interactors (59)
Accession #Entities Entities Confidence Score Evidence (IntAct)
 UniProt:P03129 VE7      0.969 28
 UniProt:Q01094 E2F1  2 0.963 24
 UniProt:Q13547 HDAC1  2 0.955 18
 UniProt:P03070 LT      0.927 9
 UniProt:P03255 E1A      0.921 10
 UniProt:Q14209 E2F2  1 0.78 5
 UniProt:P06788 VE7      0.772 4
 UniProt:P62136 PPP1CA  1 0.771 5
 UniProt:O00716 E2F3  2 0.77 4
 UniProt:Q00987 MDM2  11 0.734 5
 UniProt:P04020 VE7      0.702 3
 UniProt:P03255-2      0.702 3
 UniProt:P06464 VE7      0.688 3
 UniProt:Q14186 TFDP1  1 0.669 5
 UniProt:P06400 RB1  394 0.667 3
 UniProt:P06465 VE7      0.647 3
 UniProt:P52927  1 0.632 5
 UniProt:P24385 CCND1  4 0.623 2
 UniProt:P30285 Cdk4  6 0.623 2
 UniProt:P24941 CDK2  5 0.623 3
 UniProt:Q16539 MAPK14  7 0.623 4
 UniProt:P39880 CUX1  2 0.611 4
 UniProt:P62993 GRB2  1 0.61 4
 UniProt:Q15329 E2F5  1 0.609 2
 UniProt:O96017 CHEK2  3 0.602 3
 UniProt:Q923E4 Sirt1  2 0.602 4
 UniProt:Q14686 NCOA6  1 0.593 3
 UniProt:Q96PU4 UHRF2  1 0.591 4
 UniProt:Q13574-2 DGKZ      0.591 6
 UniProt:P03255-1      0.589 2
 UniProt:Q3TKT4  1 0.573 4
 UniProt:Q93009 USP7  2 0.571 8
 UniProt:Q9Y463 DYR1B      0.567 3
 UniProt:Q13627 DYRK1A  1 0.567 3
 UniProt:Q99708 RBBP8  4 0.564 2
 UniProt:Q14188 TFDP2  1 0.564 2
 UniProt:P03254 E1A      0.558 3
 UniProt:O14757 CHEK1  3 0.558 3
 UniProt:P0C6X7-PRO_0000037321 REP      0.556 3
 UniProt:Q8VSP9 OSPF      0.544 2
 IntAct:EBI-971875 DGKZ-MARCKS-PSD      0.544 2
 UniProt:P55345 ANM2      0.544 3
 UniProt:Q9R002 IFI2      0.544 5
 UniProt:P42685 FRK  4 0.544 3
 UniProt:Q9Y676 MRPS18B  1 0.525 2
 UniProt:Q16254 E2F4  1 0.524 3
 UniProt:O15151 MDM4  5 0.524 4
 UniProt:Q86500-PRO_0000041225      0.524 3
 UniProt:A0MPS7 A0MPS7      0.524 2
 UniProt:P07197 NFM      0.524 2
 UniProt:Q9UQ80 PA2G4  2 0.524 4
 UniProt:Q00577 PURA      0.524 6
 UniProt:P24863 CCNC  1 0.524 4
 UniProt:O75150 RNF40  1 0.508 3
 UniProt:Q9UKV8 AGO2  2 0.499 3
 UniProt:P29375 KDM5A  1 0.499 2
 UniProt:Q14653 IRF3  4 0.499 2
 UniProt:O43524 FOXO3  9 0.499 2
 UniProt:Q5R372-2 RABGAP1L      0.488 2
Cite Us!