TP53 L111Rfs*37 [nucleoplasm]

Stable Identifier
Protein [EntityWithAccessionedSequence]
Homo sapiens
TP53 L111Rfs*37 [nucleoplasm] icon
Locations in the PathwayBrowser
External Reference Information
External Reference
Gene Names
TP53, P53
Other Identifiers
Other forms of this molecule
Modified Residues
Replacement of residues 111 to 146 by RLLAFWDSQVCDLHVLPCPQQDVLPTGQDLPCAAVG
Name Identifier Synonyms
cancer DOID:162 malignant tumor, malignant neoplasm, primary cancer
Cross References
ZINC - Substances
ZINC target
Pharos - Targets
ZINC - Predictions - Purchasable
Interactors (210)
Accession #Entities Entities Confidence Score Evidence (IntAct)
 UniProt:Q00987 MDM2  11 0.994 98
 UniProt:P04637 TP53  1328